| Protein: 328778152 XP_392925.3 PREDICTED: hypothetical protein LOC409410 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 59* | 19.4 | 21.6 | 2.7314816 | 0.8981481 |
| Brain | |||||
| Crop | 56.5 | 43.5 | 1.2988505 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 5.6 | 94.4 | 0.059322033 | ||
| Rectum | |||||
| Salivary gland, cerebral | 62.9 | 37.1 | 1.6954178 | ||
| Salivary gland, thoracic | 44.1 | 20.9 | 35 | 1.26 | 0.5971429 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 84.4 | 15.6 | 5.4102564 | ||
| Malpighian tubules | 35.9 | 31.5 | 32.5 | 1.1046153 | 0.9692308 |
| Nerve chord | 56.4 | 12.6 | 30.9 | 1.8252428 | 0.407767 |
| Poison sac | |||||
| Sting | |||||
| Heart | 38 | 30.2 | 31.7 | 1.1987382 | 0.95268136 |
| Hypopharyngeal gland | 15.6 | 84.4 | 0.18483412 | ||
| Galea | |||||
| Glossa | 44.9 | 55.1 | 0.81488204 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 48.3 | 29 | 43.8 | 1.1027397 | 0.66210043 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MENMYSIAVTNKFSLALGDDEDPHEKLREEELKKEARKKEKLSEKENKSKQTDAQKGTGN KTQKNRVIKDSQQQPSKVQDLKKDQGDKKPSQSRTGGGDRNVKFSGESREERNNRRNRED GERTPRGQGELRRGPPGEGRETREFRNSNDNQRGDYGERRGRGGMRGMVRGRGGSRGRGG YDYRGKREFDRQSGSDKTSGIKPVDKKDGAGSHNWGTHNDEIEESLNQESQDWTNEKTDG DTNQTTTEIKEGEATTDTVEEKPVEEESRELTLDEWKALRNNRVKPQYNLRKAGEGEDLT RWKKMYALERKKEGADDEEEEEEEYDAAAEYPQRVGRQKRVLGIEIQFSDSRRGSGGRGR GRGRGERANGRGFGNRGAPRDGDSRGPASQSEQRSPRGRQNAPKVDDENDFPSLG |
 Top
| |