| Protein: 48096836 XP_392533.1 PREDICTED: ras-related protein Rab-6A |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 53.1 | 46.9 | 1.1321962 | ||
| Scape | 47.8 | 17.3 | 34.9 | 1.3696275 | 0.495702 |
| Brain | 49.1 | 16 | 34.9 | 1.4068768 | 0.45845273 |
| Crop | 62.7 | 37.3 | 1.6809652 | ||
| Eye | |||||
| Intestine | 54 | 46 | 1.173913 | ||
| Leg, front | 40.5 | 23.5 | 36 | 1.125 | 0.6527778 |
| Leg, middle | 55.7 | 44.3 | 1.2573364 | ||
| Leg, rear | 33.1 | 35.4 | 31.5 | 1.0507936 | 1.1238096 |
| Mandibular gland | 33.3 | 66.7 | 0.49925038 | ||
| Rectum | 54.8 | 45.2 | 1.2123893 | ||
| Salivary gland, cerebral | 71.1 | 28.9 | 2.4602077 | ||
| Salivary gland, thoracic | 47.9 | 14.9 | 37.2 | 1.2876344 | 0.40053764 |
| Sternite | |||||
| Tergite | 52.2 | 47.8 | 1.0920502 | ||
| Ventriculus | 63.5 | 36.5 | 1.7397261 | ||
| Thoracic muscle | |||||
| Fat body | 55.3 | 23.3 | 21.4 | 2.5841122 | 1.088785 |
| Malpighian tubules | 34.8 | 33.9 | 31.3 | 1.111821 | 1.083067 |
| Nerve chord | 24.5 | 46.4 | 29 | 0.8448276 | 1.6 |
| Poison sac | |||||
| Sting | 34.4 | 65.6 | 0.5243902 | ||
| Heart | 30.9 | 39.5 | 29.5 | 1.0474576 | 1.338983 |
| Hypopharyngeal gland | 34.1 | 65.9 | 0.5174507 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 46.7 | 33.6 | 40.8 | 1.1446079 | 0.8235294 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSSGDFGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDR TVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNANSFHQTSKWIDDVRTERGSDVI IMLVGNKTDLGDKRQVSMEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMDST ENKPPEDMQEVVLKDTPIELKSSESSCAC |
 Top
| |