![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328790946 XP_001122443.2 PREDICTED: hypothetical protein LOC726722 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 31.4 | 36.5 | 32.2 | 0.9751553 | 1.1335404 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 66.3 | 33.7 | 1.9673591 | ||
| Salivary gland, thoracic | 39.6 | 60.4 | 0.65562916 | ||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | 72.8 | 27.2 | 2.6764705 | ||
| Fat body | 74 | 15.3 | 10.7 | 6.915888 | 1.4299065 |
| Malpighian tubules | 37.6 | 35.1 | 27.3 | 1.3772894 | 1.2857143 |
| Nerve chord | 66.1 | 33.9 | 1.9498525 | ||
| Poison sac | |||||
| Sting | 59.9 | 40.1 | 1.4937656 | ||
| Heart | 45.3 | 28.3 | 26.4 | 1.7159091 | 1.0719697 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 54.5 | 40.2 | 32.4 | 1.6820987 | 1.2407408 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MILPKDLILLSSLIFLRVSAAFKISTRSPWINITPKPVYARALGPISEMDTITLINPPLF MAKNNVDDDTHLYKRGIFNPFNSKSFDPMNSKFESISQFSNLNTLPDYSMKNDFSHKKRS IDKSSVANLKSIMNNNKSETKGLGFPSLSPTLAPIFEEPEEDINIKKIESATVPKQYLSE MFEPYDLIGPMVDPSMFIIKKSAFLDNLFKNIAITPSLTSTEAPTTKNTIVPSDFWLPSG IPNPIVYNEKVTEFLNKLFENLKLNKTMTFNDDNMNVKNVARSIISDKDNTQVKIARSVE DLSSINAAKDSIVNSILSELSDLKSNMITTMNDLISYEKSITSPTKSFKSFDPSSWSKSL INGVFPFQQKMAILSQVFDMLTNLQKNITLEIQNVIKTKIISPERFFNANYPIINDVFSS SMPINMSLLDAIKYKLDTLDYGMPVSYIPSFDKFGSKMVRTLLKNSPFWISYPKNIANIK QEIKSESLMNEKNNFNQKQTRSVKMQIHQGYQSLPIDSIESVQTDGQSTSEHQGEEIKLF DINNYEDIDKWVNWMKYLKNKYRRYQHHNHY |
|
| |