![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66509969 XP_395883.2 PREDICTED: ubiquinone biosynthesis monooxygenase COQ6-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38 | 62 | 0.61290324 | ||
| Scape | 19.5 | 44.7 | 35.9 | 0.54317546 | 1.2451253 |
| Brain | 33.9 | 43.2 | 22.9 | 1.4803493 | 1.8864629 |
| Crop | |||||
| Eye | |||||
| Intestine | 15.2 | 29.2 | 55.5 | 0.27387387 | 0.52612615 |
| Leg, front | 68.1 | 31.9 | 2.1347961 | ||
| Leg, middle | 65.1 | 34.9 | 1.8653295 | ||
| Leg, rear | |||||
| Mandibular gland | 18.1 | 81.9 | 0.22100122 | ||
| Rectum | |||||
| Salivary gland, cerebral | 7* | 93 | 0.07526882 | ||
| Salivary gland, thoracic | 35.9 | 34.4 | 29.8 | 1.204698 | 1.1543624 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 16.6 | 28.4 | 55 | 0.3018182 | 0.5163636 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 23 | 44.7 | 50.3 | 0.45725647 | 0.888668 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MATFGKAMTFCDVLALTLKRCIISNGSMLPAKPFSISTQNHENYDIIITGGGMVGSTLAC AIANNRKLECKKILLLESNKQHEYKSQEKYSNRVVALNKQTRCLLSSIGAWQHIEAIRYS TVRKMQVWDACSDAMIVFNEDYLTEEIAYIVENDLLLHAVNKQLADKENVNIIYNSKVEN IKLPKTQEEDAVIQLQDGTKYKSKLLIGADGVNSLVRKTMNTQYVKWDYNQMGIVATLKL SEPGENVVAWQRFLPSGPIALLPLTNDLSSLVWSLPIDEAKRLLKVSEEEFVDNINNALW KVYPKDGIVESGMKALQQLLEGLSLQTGVVRQLQPSISTISEGSRAAFPLQFGHSVSYVQ TGTVLVGDAAHRVHPLAGQGVNLGFGDITVLVQLLAEAVISGVPIGNMMYLRKYETLRQR YNVPIMFAIDALHRLYNGTAAPIVLVRSLGLQLTNAIPVIKKALIEHASGQIET |
|
| |