| Protein: 110759577 XP_001120801.1 PREDICTED: cytochrome b5-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 25.5 | 38.1 | 36.5 | 0.69863015 | 1.0438356 |
| Scape | 34.9 | 37.9 | 27.2 | 1.2830882 | 1.3933823 |
| Brain | |||||
| Crop | 32.2 | 34.6 | 33.2 | 0.9698795 | 1.0421686 |
| Eye | 49.9 | 50.1 | 0.996008 | ||
| Intestine | 24.4 | 52.1 | 23.5 | 1.0382979 | 2.2170212 |
| Leg, front | 30.2 | 28.9 | 40.9 | 0.73838633 | 0.70660144 |
| Leg, middle | 24.5 | 27.9 | 47.6 | 0.5147059 | 0.58613443 |
| Leg, rear | 23.7 | 34.3 | 42 | 0.5642857 | 0.81666666 |
| Mandibular gland | 4.3 | 80.2 | 15.5 | 0.27741936 | 5.1741934 |
| Rectum | 32.9 | 25.4 | 41.7 | 0.7889688 | 0.60911274 |
| Salivary gland, cerebral | 51.4 | 34.5 | 14.1 | 3.64539 | 2.4468086 |
| Salivary gland, thoracic | 26.8 | 28.9 | 44.3 | 0.60496616 | 0.6523702 |
| Sternite | 4.5* | 29.2 | 66.4 | 0.067771085 | 0.43975905 |
| Tergite | 3.9 | 43.5 | 52.6 | 0.07414449 | 0.8269962 |
| Ventriculus | 41.4 | 29.3 | 29.3 | 1.4129692 | 1 |
| Thoracic muscle | |||||
| Fat body | 21 | 30.6 | 48.4 | 0.4338843 | 0.6322314 |
| Malpighian tubules | 33.8 | 24.3 | 41.9 | 0.8066826 | 0.57995224 |
| Nerve chord | 24.6 | 36.7 | 38.7 | 0.6356589 | 0.9483204 |
| Poison sac | |||||
| Sting | 27.4 | 72.6 | 0.37741047 | ||
| Heart | 22.5 | 37.2 | 40.2 | 0.5597015 | 0.92537314 |
| Hypopharyngeal gland | 32.4 | 67.6 | 0.47928995 | ||
| Galea | 26 | 22.5 | 51.6 | 0.503876 | 0.4360465 |
| Glossa | 33.7 | 32 | 34.3 | 0.9825073 | 0.9329446 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 26.1 | 35.6 | 41.7 | 0.62589926 | 0.853717 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSKQFTRSEVAKLSNKDKTLIILHDKVYDVTSFLNEHPGGEEVLLDHSGIDGSEDFDDVG HSTDAFDLMTKYQVGELVESEKTGNLPKKTWAKDHFKSNKTNQGENQGMPTTMVVSILAV LAAIVYFVYL |
 Top
| |