| Protein: 66534750 XP_393381.2 PREDICTED: peptidyl-prolyl cis-trans isomerase-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 31.2 | 41.1 | 27.8 | 1.1223022 | 1.4784173 |
| Scape | 37.6 | 32.4 | 29.9 | 1.2575251 | 1.0836121 |
| Brain | 30.9 | 27.4 | 41.7 | 0.7410072 | 0.65707433 |
| Crop | 26.5 | 46.4 | 27.1 | 0.9778598 | 1.7121772 |
| Eye | 38.8 | 38.1 | 23.1 | 1.6796536 | 1.6493506 |
| Intestine | 34.2 | 37.7 | 28.1 | 1.2170819 | 1.341637 |
| Leg, front | 41.1 | 35.3 | 23.6 | 1.7415254 | 1.4957627 |
| Leg, middle | 38.4 | 36.1 | 25.4 | 1.511811 | 1.4212599 |
| Leg, rear | 34.7 | 36.8 | 28.6 | 1.2132868 | 1.2867132 |
| Mandibular gland | 53 | 21.5 | 25.5 | 2.0784314 | 0.84313726 |
| Rectum | 49.8 | 14.8 | 35.4 | 1.4067796 | 0.4180791 |
| Salivary gland, cerebral | 76.9 | 10.4 | 12.8 | 6.0078125 | 0.8125 |
| Salivary gland, thoracic | 35.6 | 28.3 | 36.1 | 0.9861496 | 0.7839335 |
| Sternite | 38.6 | 37.9 | 23.6 | 1.6355932 | 1.6059322 |
| Tergite | 33.8 | 45.7 | 20.5 | 1.6487805 | 2.2292683 |
| Ventriculus | 22.4 | 50.1 | 27.5 | 0.81454545 | 1.8218182 |
| Thoracic muscle | |||||
| Fat body | 49.7 | 29.4 | 20.9 | 2.3779905 | 1.4066986 |
| Malpighian tubules | 35 | 32.4 | 32.7 | 1.0703363 | 0.9908257 |
| Nerve chord | 33.6 | 37.4 | 29 | 1.1586207 | 1.2896552 |
| Poison sac | 23.9 | 76.1 | 0.31406045 | ||
| Sting | 63.5 | 36.5 | 1.7397261 | ||
| Heart | 41.2 | 32.7 | 26.1 | 1.578544 | 1.2528735 |
| Hypopharyngeal gland | 38.1 | 61.9 | 0.6155089 | ||
| Galea | 33.8 | 24.3 | 41.9 | 0.8066826 | 0.57995224 |
| Glossa | 25.2 | 33 | 41.8 | 0.6028708 | 0.7894737 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.3 | 34.2 | 32.1 | 1.1931465 | 1.0654205 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MALRSICRLSIDSTFSHLSHLGATARPRRSSFALLVRSFAVIAEEMGLPRVFFDMTADTK PVGRIVMELRSDVVPKTAENFRALCTGEKGFGYKGSSFHRVIPNFMCQGGDFTNHNGTGG KSIYGVRFDDENFTLKHTEPGILSMANAGPNTNGSQFFITSAKTSWLDGKHVVFGKVVEG MDVVRKLEAMGSQSGKTSKKIVITDCGEM |
 Top
| |