| Protein: 110751310 XP_001120162.1 PREDICTED: endoplasmic reticulum resident protein 29-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 62.6 | 37.4 | 1.6737968 | ||
| Scape | 48.6 | 19 | 32.5 | 1.4953846 | 0.5846154 |
| Brain | |||||
| Crop | 38.8 | 37.4 | 23.8 | 1.6302521 | 1.5714285 |
| Eye | |||||
| Intestine | 95.3* | 4.7 | 20.276596 | ||
| Leg, front | |||||
| Leg, middle | 13.3* | 86.7 | 0.15340254 | ||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 76.6 | 23.4 | 3.2735043 | ||
| Salivary gland, thoracic | 57.1 | 13.9 | 29 | 1.9689655 | 0.47931033 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | 70.7 | 29.3 | 2.4129694 | ||
| Thoracic muscle | |||||
| Fat body | 87.9 | 6.8 | 5.3 | 16.584906 | 1.2830188 |
| Malpighian tubules | 68.4 | 9.6 | 22 | 3.1090908 | 0.43636364 |
| Nerve chord | 56.2* | 22.9 | 21 | 2.6761904 | 1.0904762 |
| Poison sac | 51.3 | 48.7 | 1.0533881 | ||
| Sting | 40.4 | 59.6 | 0.67785233 | ||
| Heart | 34.4 | 38 | 27.6 | 1.2463768 | 1.3768116 |
| Hypopharyngeal gland | 10.2 | 89.8 | 0.11358575 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 63.3 | 23.9 | 36.1 | 1.7534626 | 0.6620499 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLSSIVIFLIIGIAAAEDCKGCVSLDSYSFDKVIPKFKAAIVKFDVAFPYGEKHEQYAQI AAATKDSHDLLVAEVRVKDYGNKDNSDLATRYKIKSEAFPAILLFLQGKTDPILFVAEKE TDFTADNIKRFVKTKSGIYLGLPGCVEQLDRLAEEFRTSGESERKEILNKAKVFEETLPE IQRAAAKVYVKTMEKILEKGDVFVQTEQTRIEGILKGKLSNEKKRTMEEKRNILHSFLYR DEL |
 Top
| |