| Protein: 66512983 XP_393293.2 PREDICTED: esterase E4-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 1.5 | 94.6* | 3.9 | 0.3846154 | 24.25641 |
| Scape | 0.2* | 91.7* | 8 | 0.025 | 11.4625 |
| Brain | |||||
| Crop | 33 | 67 | 0.49253732 | ||
| Eye | |||||
| Intestine | 3.1* | 96.9 | 0.031991743 | ||
| Leg, front | 2* | 76.3* | 21.8 | 0.09174312 | 3.5 |
| Leg, middle | 1.6* | 79.4* | 19 | 0.08421052 | 4.1789474 |
| Leg, rear | 1.2* | 73.8 | 25 | 0.048 | 2.952 |
| Mandibular gland | 4.1 | 30.5 | 65.4 | 0.06269113 | 0.46636087 |
| Rectum | |||||
| Salivary gland, cerebral | 18.7 | 81.3 | 0.2300123 | ||
| Salivary gland, thoracic | 0.7* | 74 | 25.3 | 0.027667984 | 2.9249012 |
| Sternite | 2.7 | 73.4 | 24 | 0.1125 | 3.0583334 |
| Tergite | 1* | 36.3 | 62.7 | 0.015948962 | 0.57894737 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 2.2* | 23.4 | 74.4 | 0.029569892 | 0.31451613 |
| Malpighian tubules | 3.7* | 47.5 | 48.7 | 0.07597536 | 0.9753593 |
| Nerve chord | 86.8* | 13.2 | 6.5757575 | ||
| Poison sac | |||||
| Sting | 33.8 | 66.2 | 0.51057404 | ||
| Heart | 1.8* | 56.6 | 41.7 | 0.043165468 | 1.3573141 |
| Hypopharyngeal gland | |||||
| Galea | 0.9* | 52.1 | 47 | 0.019148936 | 1.1085106 |
| Glossa | 0.9* | 37.9 | 61.2 | 0.014705882 | 0.61928105 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 1.8 | 56.7 | 44.9 | 0.040089086 | 1.2628062 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKYNTLISILCIVGAVVCDCSTNIEQPLVEAPIGKIRGSIIVSRHGRKIYSFRGIRYGEP PVGKQRFQPPIPAADWRNVFDATEEGPSCPHPDGVFQAEDCLRLNVYTTKLPCEEQNVKR PVMIFIHPGGFTSFSGQSLIFGPQYLLDKDIVLVTINYRLGTLGFLNTGDSEAPGNMGLK DQVEAFRWVRRNIAAFGGDPNSVTLCGYSAGSFSIMLHMVSPMSKDLFHRAISMSSSAIK PEVYTGIAEHGQKELVQKQAQLLNCPTDSTASMLNCLIEKPVENFTNTLANLTDWYGNPI LLWTPAVEPQVPGVERFLSEQPYDSIALGKFHQVPYILGVTEHEFAGVAALYERNDKVDN GSLYREVNNNWNKVAPIFCMYERNTSRSNYISRQLKQFYFKDEPISERTLLQLGKVYGDC ITIFPVYRAVKLFASKSREPVYFYKFTYEGRFGFYRWSNDTAYNPSHHDDLQYLFHAKQF PFLPYLEDDAPEAPMVELYTSMWSNFVINGEPIPRNDDRFENVSWETFDPSRTNYLEINL RLGMKTEFFPERMRLWETLFPLPSQPSRGVKH |
 Top
| |