| Protein: 94158718 NP_001035296.1 odorant binding protein 21 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 5.1* | 47 | 47.9 | 0.10647181 | 0.9812108 |
| Scape | 1* | 95.7* | 3.4 | 0.29411766 | 28.147058 |
| Brain | |||||
| Crop | 72.6* | 27.4 | 2.649635 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | 11.4* | 36.9 | 51.7 | 0.2205029 | 0.7137331 |
| Leg, middle | 10* | 30.8 | 59.1 | 0.16920474 | 0.5211506 |
| Leg, rear | 2.6* | 43 | 54.4 | 0.04779412 | 0.79044116 |
| Mandibular gland | 2.2 | 71.5 | 26.3 | 0.08365019 | 2.7186313 |
| Rectum | |||||
| Salivary gland, cerebral | 2.2* | 24.9 | 73 | 0.030136986 | 0.3410959 |
| Salivary gland, thoracic | 82.2* | 17.8 | 4.6179776 | ||
| Sternite | 1.6* | 21 | 77.4 | 0.020671835 | 0.27131784 |
| Tergite | 3.6 | 67.3 | 29 | 0.12413793 | 2.3206897 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 21.7 | 34.8 | 43.5 | 0.49885058 | 0.8 |
| Malpighian tubules | |||||
| Nerve chord | 1.6* | 83.4* | 15 | 0.10666667 | 5.56 |
| Poison sac | |||||
| Sting | 9.4* | 90.6 | 0.10375276 | ||
| Heart | 4.4* | 22.4* | 73.2 | 0.06010929 | 0.30601093 |
| Hypopharyngeal gland | 87 | 13 | 6.6923075 | ||
| Galea | 10.1* | 37.8 | 52 | 0.19423077 | 0.72692305 |
| Glossa | 32 | 68 | 0.47058824 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 6 | 50 | 45.7 | 0.13129103 | 1.0940919 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKTIVIISAICVCVGALTLEELQIGLRAVIPVCRIDSGIDEKKEDDFRNGIIDVENEKVQ LFSECLIKKFNAYDDGGNFNEVVVREIAEIYLDENEVNKLITECSAISDADIHLKSSKLI KCFAKYKTLKEIMNE |
 Top
| |