| Protein: 48141950 XP_397284.1 PREDICTED: mitochondrial import receptor subunit TOM20 homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 53.9 | 15.6 | 30.5 | 1.7672131 | 0.5114754 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 44.4 | 55.6 | 0.79856116 | ||
| Leg, front | |||||
| Leg, middle | 20.1* | 79.9 | 0.25156444 | ||
| Leg, rear | |||||
| Mandibular gland | 35.7 | 64.3 | 0.55520993 | ||
| Rectum | |||||
| Salivary gland, cerebral | 83.8 | 16.2 | 5.1728396 | ||
| Salivary gland, thoracic | 28.7 | 34 | 37.3 | 0.769437 | 0.91152817 |
| Sternite | 41.5 | 26.1 | 32.5 | 1.2769231 | 0.8030769 |
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 35.7 | 33 | 31.3 | 1.140575 | 1.0543131 |
| Malpighian tubules | 46.9 | 26.4 | 26.7 | 1.7565544 | 0.98876405 |
| Nerve chord | 60.5 | 39.5 | 1.5316455 | ||
| Poison sac | |||||
| Sting | |||||
| Heart | 12 | 44 | 43.9 | 0.2733485 | 1.0022779 |
| Hypopharyngeal gland | 24.1 | 75.9 | 0.31752306 | ||
| Galea | |||||
| Glossa | 39.6 | 60.4 | 0.65562916 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 44.3 | 30.7 | 45.7 | 0.9693654 | 0.6717724 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTMISKAAVGIAVGIAGIFVGYCFYFDQKRRSDPDFKKKLRERRKAKKQAQNATSKIQDL KDHEVVQRFFLQEVQLGEEMLSCGDIEGAVEHLGNAVAVCGQPAQLLQVLQKTLPPQIFH LLLQRLQPISQKLSTQIAMAEEDVE |
 Top
| |