| Protein: 48104474 XP_395789.1 PREDICTED: NADH dehydrogenase [ubiquinone] iron-sulfur protein 6 mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.6 | 34.5 | 35 | 0.8742857 | 0.98571426 |
| Scape | 51.4 | 20.1 | 28.5 | 1.8035088 | 0.70526314 |
| Brain | 20 | 80 | 0.25 | ||
| Crop | 45.7 | 54.3 | 0.8416206 | ||
| Eye | |||||
| Intestine | 35.2 | 24.6 | 40.2 | 0.8756219 | 0.6119403 |
| Leg, front | 28.7 | 36.7 | 34.6 | 0.82947975 | 1.0606936 |
| Leg, middle | 52.5 | 21.3 | 26.2 | 2.0038168 | 0.8129771 |
| Leg, rear | 13.9 | 23.9 | 62.2 | 0.22347267 | 0.38424438 |
| Mandibular gland | 26 | 14.4 | 59.7 | 0.43551087 | 0.24120604 |
| Rectum | 68.2 | 31.8 | 2.144654 | ||
| Salivary gland, cerebral | 48.6 | 13.8 | 37.7 | 1.2891247 | 0.36604774 |
| Salivary gland, thoracic | 30.8 | 41.9 | 27.3 | 1.1282052 | 1.5347985 |
| Sternite | 28.5 | 30.9 | 40.6 | 0.70197046 | 0.7610837 |
| Tergite | 29.3 | 70.7 | 0.41442716 | ||
| Ventriculus | |||||
| Thoracic muscle | 22.3 | 62.4 | 15.3 | 1.4575163 | 4.0784316 |
| Fat body | 35.7 | 46.1 | 18.2 | 1.9615384 | 2.532967 |
| Malpighian tubules | 40.6 | 21.1 | 38.3 | 1.0600523 | 0.5509138 |
| Nerve chord | 48.7 | 12.6 | 38.7 | 1.2583979 | 0.3255814 |
| Poison sac | |||||
| Sting | 43.8 | 56.2 | 0.77935946 | ||
| Heart | 50.2 | 16 | 33.8 | 1.4852071 | 0.4733728 |
| Hypopharyngeal gland | 51 | 49 | 1.0408163 | ||
| Galea | 34.6 | 65.4 | 0.52905196 | ||
| Glossa | 58.9 | 6.4* | 34.7 | 1.6974063 | 0.18443803 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.2 | 28.8 | 42.5 | 0.92235297 | 0.67764705 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MASIKIMEFFKTSNRKYKINTIGLIIRNIHDVTSKSAKKVTHTGQIYDEDDYRNVRFVNR PKEVNDNWAIKLIAEASPTSAKEKIVACDGGGGPLGHPKVYINLDKPGNHTCGYCGLRFY KEDH |
 Top
| |