Home List proteins by tissue Protein search Downloads Links
Protein: 229892214 NP_001153524.1 heat shock protein cognate 3
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 49.3 21.7 29.1 1.6941581 0.7457045
Scape 43.5 24.3 32.1 1.3551402 0.7570093
Brain 59.2 19 21.8 2.7155964 0.8715596
Crop 25.3 35.3 39.5 0.6405063 0.89367086
Eye 49.7 32.6 17.7 2.8079095 1.841808
Intestine 42.5 36.4 21.2 2.0047169 1.7169812
Leg, front 36.3 34 29.7 1.2222222 1.1447811
Leg, middle 29.8 36.7 33.6 0.8869048 1.0922619
Leg, rear 40.6 33.6 25.8 1.5736434 1.3023256
Mandibular gland 34 37.5 28.5 1.1929824 1.3157895
Rectum 21.9 44.3 33.8 0.647929 1.310651
Salivary gland, cerebral 75.2 16.8 8 9.4 2.1
Salivary gland, thoracic 47.2 20.7 32.2 1.4658386 0.64285713
Sternite 22.1 47 30.9 0.7152104 1.5210356
Tergite 11.7 66.7 21.6 0.5416667 3.0879629
Ventriculus 37 41.2 21.8 1.6972477 1.8899083
Thoracic muscle 20.9 64.6 14.5 1.4413793 4.4551725
Fat body 50.7 30.6 18.7 2.71123 1.6363636
Malpighian tubules 37.3 29.2 33.6 1.1101191 0.86904764
Nerve chord 46.1 24.1 29.8 1.5469799 0.8087248
Poison sac 75.5 24.5 3.0816326
Sting 49.6 50.4 0.984127
Heart 26.3 42.2 31.5 0.83492064 1.3396826
Hypopharyngeal gland 49 51 0.9607843
Galea 37 26.6 36.4 1.0164835 0.7307692
Glossa 38.3 20.8 40.9 0.93643034 0.50855744
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 38.3 36.9 29.2 1.3116438 1.2636986
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MKKMKGVKALFLLGLITFAFAKEEKQKEDIGTVIGIDLGTTYSCVGVYKNGRAEIIANDQ
GNRITPSYVAFTADGERLIGDAAKNQLTTNPENTVFDAKRLIGREWSDPTVQRDIKSFPF
KVIEKNSKPHIRMVINGEEKVFAPEEISAMVLGKMKETAEAYLGKKVTHAVVTVPAYFND
AQRQATKDAGTISGLVVMRIINEPTAAAIAYGLDKKDGEKNVLVFDLGGGTFDVSLLTID
NGVFEVVATNGDTHLGGEDFDLRVMDHFTKLYKKKKGKDIRKDSRTLQKLRREVEKAKRA
LSVSHQVRIEIESFFEGEDFSETLTRAKFEELNMDLFRSTLKPVQKVLEDSDMNKKDVDE
IVLVGGSTRIPKVQQLVKEFFGGKEPSRGINPDEAVAYGAAVQAGVLSGEQDTDAIVLLD
VNPLTMGIETVGGVMTKLIPRNTVIPTKKSQIFSTASDNQHTVTIQVYEGERPMTKDNHP
LGKFDLTGIPPAPRGIPQIEVTFEIDANGILQVSAEDKGTGNREKIVITNDQNRLTPDDI
ERMIKDAEKFADDDKKLKERVEARNELESYAYSLKNQLADKEKLGSKVSDSDKAKMEEAI
DEKIKWLEENADTDPEEYKKQKKELTDIVQPIIAKLYQGAGGGVPPTGGDDEDLKDEL

Top