| Protein: 66558942 XP_623672.1 PREDICTED: t-complex protein 1 subunit delta-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40.8 | 59.2 | 0.6891892 | ||
| Scape | 31.9 | 34.8 | 33.3 | 0.957958 | 1.045045 |
| Brain | 42.3 | 57.7 | 0.73310226 | ||
| Crop | 40.9 | 26.3 | 32.8 | 1.2469512 | 0.8018293 |
| Eye | 58.8 | 41.2 | 1.4271845 | ||
| Intestine | 23.5 | 41.4 | 35.2 | 0.6676136 | 1.1761364 |
| Leg, front | 28.7 | 34.3 | 37.1 | 0.7735849 | 0.9245283 |
| Leg, middle | 32.9 | 30.6 | 36.5 | 0.90136987 | 0.83835614 |
| Leg, rear | 40.6 | 35.3 | 24.2 | 1.677686 | 1.4586776 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 48.9 | 10.5 | 40.6 | 1.2044334 | 0.25862068 |
| Salivary gland, thoracic | 29.7 | 35.2 | 35.1 | 0.84615386 | 1.002849 |
| Sternite | |||||
| Tergite | 87.8 | 12.2 | 7.196721 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 36.5 | 27.5 | 36 | 1.0138888 | 0.7638889 |
| Malpighian tubules | 34.4 | 25 | 40.5 | 0.8493827 | 0.61728394 |
| Nerve chord | 28.5 | 26.7 | 44.9 | 0.63474387 | 0.5946548 |
| Poison sac | |||||
| Sting | 50.2 | 49.8 | 1.0080321 | ||
| Heart | 22.9 | 32.7 | 44.4 | 0.5157658 | 0.7364865 |
| Hypopharyngeal gland | 24.5 | 75.5 | 0.3245033 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.1 | 31.8 | 40.9 | 0.9559902 | 0.7775061 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTAITASGDGRNAHGQAYKDKSKPTDIRSSNINAAKAVSDAIRTSLGPRGMDKMIQAGNG EVTITNDGATILKEMNVVHPAAKMLVELSKAQDVEAGDGTTSVVVIAGSLLEAAERLLQK GIHPTLISDSFQKAAAKAVEILTNMSIPVDLRDKQSLIRAAATSLNSKVVFQQSSLLAPL AVDAVLKVTEEGKESTVDLNNIKVIKKLGGTVEDTELVEGLIFTQKSCNVNGPKRIEKAK IGLIQFCISPPKTDMDHNVIVSDYAAMDRVLKEERTYILNIVKQIKKTGCNVLLVQKSIL RDAVSDLAIHFLDKIKVMVIKDIEREDISFVCKTLGCRPIASLDHFVAENLVNAELCEEV QTGSSKFVKITKIQNPGPTVTVLVRGSNKLVLEEAERSLHDALCVVRCLVKQKALIAGGG APEIELALKLGAYAQTLTGVDAYCINAFANAFEIIPSTLAENAGLNPIATVTELRNRHAK GEHTTGINVRKGSITNILEENVIQPLLVSTSAITLASETVRSILKIDDIVNTNQ |
 Top
| |