| Protein: 48096523 XP_392479.1 PREDICTED: 14-3-3 protein epsilon isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 40 | 28.4 | 31.6 | 1.2658228 | 0.89873415 |
| Scape | 36.5 | 29.9 | 33.5 | 1.0895523 | 0.8925373 |
| Brain | 40.1 | 23 | 36.9 | 1.0867208 | 0.6233062 |
| Crop | 36.3 | 32.2 | 31.5 | 1.152381 | 1.0222223 |
| Eye | 21.8 | 38.1 | 40.1 | 0.5436409 | 0.9501247 |
| Intestine | 25.6 | 43.8 | 30.6 | 0.8366013 | 1.4313725 |
| Leg, front | 38.2 | 33.2 | 28.6 | 1.3356644 | 1.1608392 |
| Leg, middle | 28.8 | 37 | 34.2 | 0.84210527 | 1.0818714 |
| Leg, rear | 48.6 | 32.5 | 18.9 | 2.5714285 | 1.7195767 |
| Mandibular gland | |||||
| Rectum | 50.4 | 31.2 | 18.3 | 2.7540984 | 1.704918 |
| Salivary gland, cerebral | 73 | 27 | 2.7037036 | ||
| Salivary gland, thoracic | 39.6 | 25.4 | 35 | 1.1314286 | 0.72571427 |
| Sternite | 77.4 | 22.6 | 3.4247787 | ||
| Tergite | 37.7 | 43.3 | 19 | 1.9842105 | 2.2789474 |
| Ventriculus | 73.5 | 26.5 | 2.7735848 | ||
| Thoracic muscle | |||||
| Fat body | 51.3 | 24.5 | 24.2 | 2.1198347 | 1.0123967 |
| Malpighian tubules | 30.3 | 51.4* | 18.2 | 1.6648352 | 2.8241758 |
| Nerve chord | 32.6 | 29.8 | 37.6 | 0.86702126 | 0.7925532 |
| Poison sac | |||||
| Sting | 72.6 | 27.4 | 2.649635 | ||
| Heart | 33 | 34.9 | 32.1 | 1.0280374 | 1.0872275 |
| Hypopharyngeal gland | 38.1 | 61.9 | 0.6155089 | ||
| Galea | 52.8* | 28.3 | 18.9 | 2.7936509 | 1.4973545 |
| Glossa | 30.7 | 48.3 | 21 | 1.4619048 | 2.3 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.3 | 39.9 | 29.4 | 1.3367347 | 1.3571428 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSEREDNVYKAKLAEQAERYDEMVEAMKKVASLDVELTVEERNLLSVAYKNVIGARRASW RIISSIEQKEENKGAERKLEMIRQYRSQVEKELKDICADILGVLDKHLLPCASTGESKVF YYKMKGDYHRYLAEFAVGNDRKEAAENSLVAYKAASDTAMTDLPPTHPIRLGLALNFSVF YYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDGE GEQKEQLPDVEDQDVS |
 Top
| |