![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328787470 XP_001120036.2 PREDICTED: fasciclin-3 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 45.8 | 20.4 | 33.8 | 1.3550296 | 0.6035503 |
| Scape | 53.8 | 17.3 | 28.9 | 1.8615917 | 0.59861594 |
| Brain | 67.3 | 32.7 | 2.058104 | ||
| Crop | 36.2 | 26.8 | 37 | 0.97837836 | 0.72432435 |
| Eye | 17.5 | 24.6 | 57.8 | 0.30276817 | 0.42560554 |
| Intestine | 45.5 | 26.2 | 28.3 | 1.6077739 | 0.9257951 |
| Leg, front | 39 | 26.8 | 34.2 | 1.1403508 | 0.7836257 |
| Leg, middle | 43.7 | 20.4 | 35.9 | 1.2172701 | 0.5682451 |
| Leg, rear | 23.6 | 32.3 | 44.1 | 0.53514737 | 0.7324263 |
| Mandibular gland | 24.1 | 5 | 70.9 | 0.33991536 | 0.07052186 |
| Rectum | 51.3 | 48.7 | 1.0533881 | ||
| Salivary gland, cerebral | 77.3 | 22.7 | 3.4052863 | ||
| Salivary gland, thoracic | 49.7 | 13.6 | 36.7 | 1.3542235 | 0.3705722 |
| Sternite | 26.2 | 25.7 | 48.1 | 0.54469854 | 0.53430355 |
| Tergite | 39.6 | 8* | 52.4 | 0.7557252 | 0.15267175 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 89.2* | 6.8 | 4 | 22.3 | 1.7 |
| Malpighian tubules | 27.4 | 50.7 | 21.9 | 1.2511415 | 2.3150685 |
| Nerve chord | 23.9 | 46.6 | 29.5 | 0.8101695 | 1.579661 |
| Poison sac | |||||
| Sting | 29.4 | 70.6 | 0.4164306 | ||
| Heart | 18.4 | 50.4 | 31.2 | 0.5897436 | 1.6153846 |
| Hypopharyngeal gland | 58.5 | 41.5 | 1.4096385 | ||
| Galea | 39.9 | 20.6 | 39.5 | 1.0101266 | 0.521519 |
| Glossa | 40 | 22.3 | 37.7 | 1.061008 | 0.59151196 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.4 | 27.8 | 38.6 | 1.0725389 | 0.7202073 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MCMESTSNFKMTLAWVCLIGLLCSTAVKASKSNLVVDIEPKRPTAVRLGESLQILCRVGR PLRVCRVEIPGEEGGIVLSKGQPPEDGIEYYGEGTEAGQCGVRIAKIKESHDGIFKCTLT TTDSRSEEQASMRIIVAKPPNNPELHTSQGSDGRNIYRKGEKLEVSCSAPGGRPAANVSL FLDDEPIGNEERPTIYDSNVDDNSLAVQNASRALDWTDNGKVLRCVAGHIALDRPKETTM QLQVYYPPQPQSTIERFGYVIGRQGIVNVTVYANPRPRFLWRVNNEIINEGRPDESNRLE TSTAVDLGRGAWSVILTIDSVQKSDTEKEYILEARNGEGAYEYRIILSTATEPAGVDLDA GSIIGIVVGALVLLLIVFILIFARATGRWCFAGNTTSRNLGESSDTESAGRYSRTEVDGS REERKSRISLSSLFKRNKDKVSGADTDTMRTVVTVDDEKHQAAPIAQDAAKQTTDEGGIV YAELDLTQQQQNVPIRHLNEDKTEYAEILYTKSSTEEQQTPKE |
|
| |