Home List proteins by tissue Protein search Downloads Links
Protein: 328787470 XP_001120036.2 PREDICTED: fasciclin-3
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 45.8 20.4 33.8 1.3550296 0.6035503
Scape 53.8 17.3 28.9 1.8615917 0.59861594
Brain 67.3 32.7 2.058104
Crop 36.2 26.8 37 0.97837836 0.72432435
Eye 17.5 24.6 57.8 0.30276817 0.42560554
Intestine 45.5 26.2 28.3 1.6077739 0.9257951
Leg, front 39 26.8 34.2 1.1403508 0.7836257
Leg, middle 43.7 20.4 35.9 1.2172701 0.5682451
Leg, rear 23.6 32.3 44.1 0.53514737 0.7324263
Mandibular gland 24.1 5 70.9 0.33991536 0.07052186
Rectum 51.3 48.7 1.0533881
Salivary gland, cerebral 77.3 22.7 3.4052863
Salivary gland, thoracic 49.7 13.6 36.7 1.3542235 0.3705722
Sternite 26.2 25.7 48.1 0.54469854 0.53430355
Tergite 39.6 8* 52.4 0.7557252 0.15267175
Ventriculus
Thoracic muscle
Fat body 89.2* 6.8 4 22.3 1.7
Malpighian tubules 27.4 50.7 21.9 1.2511415 2.3150685
Nerve chord 23.9 46.6 29.5 0.8101695 1.579661
Poison sac
Sting 29.4 70.6 0.4164306
Heart 18.4 50.4 31.2 0.5897436 1.6153846
Hypopharyngeal gland 58.5 41.5 1.4096385
Galea 39.9 20.6 39.5 1.0101266 0.521519
Glossa 40 22.3 37.7 1.061008 0.59151196
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 41.4 27.8 38.6 1.0725389 0.7202073
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MCMESTSNFKMTLAWVCLIGLLCSTAVKASKSNLVVDIEPKRPTAVRLGESLQILCRVGR
PLRVCRVEIPGEEGGIVLSKGQPPEDGIEYYGEGTEAGQCGVRIAKIKESHDGIFKCTLT
TTDSRSEEQASMRIIVAKPPNNPELHTSQGSDGRNIYRKGEKLEVSCSAPGGRPAANVSL
FLDDEPIGNEERPTIYDSNVDDNSLAVQNASRALDWTDNGKVLRCVAGHIALDRPKETTM
QLQVYYPPQPQSTIERFGYVIGRQGIVNVTVYANPRPRFLWRVNNEIINEGRPDESNRLE
TSTAVDLGRGAWSVILTIDSVQKSDTEKEYILEARNGEGAYEYRIILSTATEPAGVDLDA
GSIIGIVVGALVLLLIVFILIFARATGRWCFAGNTTSRNLGESSDTESAGRYSRTEVDGS
REERKSRISLSSLFKRNKDKVSGADTDTMRTVVTVDDEKHQAAPIAQDAAKQTTDEGGIV
YAELDLTQQQQNVPIRHLNEDKTEYAEILYTKSSTEEQQTPKE

Top