| Protein: 328782520 XP_003250159.1 PREDICTED: protein QIL1-like isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 43.6 | 56.4 | 0.77304965 | ||
| Scape | 36.6 | 28.3 | 35.1 | 1.0427351 | 0.8062678 |
| Brain | 43.3 | 56.7 | 0.7636684 | ||
| Crop | 54.8 | 45.2 | 1.2123893 | ||
| Eye | 30.2 | 24.3 | 45.5 | 0.6637363 | 0.53406596 |
| Intestine | 39.9 | 60.1 | 0.6638935 | ||
| Leg, front | 34 | 27.7 | 38.3 | 0.88772845 | 0.7232376 |
| Leg, middle | 36.2 | 27.5 | 36.3 | 0.9972452 | 0.75757575 |
| Leg, rear | 24.2 | 34.1 | 41.6 | 0.5817308 | 0.81971157 |
| Mandibular gland | 46.3 | 53.7 | 0.8621974 | ||
| Rectum | |||||
| Salivary gland, cerebral | 22.3 | 33.7 | 44 | 0.5068182 | 0.7659091 |
| Salivary gland, thoracic | 33 | 31.2 | 35.9 | 0.91922003 | 0.8690808 |
| Sternite | 18.7 | 37 | 44.3 | 0.42212188 | 0.83521444 |
| Tergite | 37.1 | 62.9 | 0.5898251 | ||
| Ventriculus | |||||
| Thoracic muscle | 38 | 42.9 | 19 | 2 | 2.2578948 |
| Fat body | 19.4 | 43.2 | 37.4 | 0.5187166 | 1.1550802 |
| Malpighian tubules | 42.3 | 25.9 | 31.8 | 1.3301886 | 0.8144654 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 46.8 | 53.2 | 0.87969923 | ||
| Heart | 44.5 | 16.5 | 39 | 1.1410257 | 0.42307693 |
| Hypopharyngeal gland | |||||
| Galea | 30.2 | 32.9 | 36.9 | 0.81842816 | 0.89159894 |
| Glossa | 41.2 | 26.7 | 32.1 | 1.2834891 | 0.8317757 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34 | 34.3 | 43.1 | 0.7888631 | 0.7958237 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNLIRFVIKSSIVGGIVYYTYKEGLWSKSEETAALYKKLNVKIAPYVKENVPEKITKEIS QLPSVTDITNFIKVTWNKGVMSSMGFISNLPTHTFNSATSLYETTQSYIKELSV |
 Top
| |