| Protein: 328779752 XP_397224.3 PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP14-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.5 | 69.5 | 0.4388489 | ||
| Scape | 35.3 | 42 | 22.7 | 1.5550661 | 1.8502203 |
| Brain | |||||
| Crop | 32.2 | 23 | 44.8 | 0.71875 | 0.51339287 |
| Eye | 37.5 | 62.5 | 0.6 | ||
| Intestine | 45.2 | 30.7 | 24.1 | 1.8755187 | 1.2738589 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 9.1 | 90.9 | 0.10011001 | ||
| Rectum | 32 | 68 | 0.47058824 | ||
| Salivary gland, cerebral | 98.7* | 1.3 | 75.92308 | ||
| Salivary gland, thoracic | 51.1 | 15.3 | 33.6 | 1.5208334 | 0.45535713 |
| Sternite | 15.7 | 21 | 63.3 | 0.24802528 | 0.33175355 |
| Tergite | 4.8 | 68.8 | 26.4 | 0.18181819 | 2.6060605 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 35.1 | 3.2* | 61.7 | 0.5688817 | 0.051863857 |
| Malpighian tubules | 62* | 7.1* | 30.9 | 2.0064726 | 0.22977346 |
| Nerve chord | 50 | 23.9 | 26.1 | 1.9157088 | 0.91570884 |
| Poison sac | |||||
| Sting | 36.1 | 63.9 | 0.5649452 | ||
| Heart | 28.6 | 16.7* | 54.7 | 0.52285194 | 0.30530164 |
| Hypopharyngeal gland | 47.6 | 52.4 | 0.90839696 | ||
| Galea | 34.2 | 25.8 | 40.1 | 0.85286784 | 0.64339155 |
| Glossa | 18.2 | 20.8 | 60.9 | 0.29885057 | 0.34154353 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.8 | 28.1 | 47.2 | 0.779661 | 0.595339 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MQQRRQQQISLDRDQPFTFQLGVGQVIKGWDEGLVDMCVGEKRKLTIPPELGYGEKGAGN VIPGGATLLFEVELINISDSPPTANVFKEIDSDHDNQLSREEVSEYLRKQMIEAEKGSGG DSEEVKKIMADHDKLVEEIFQHEDKDKNGFISHDEFSGPKHDEL |
 Top
| |