| Protein: 66547447 XP_624910.1 PREDICTED: 10 kDa heat shock protein mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 29.1 | 37.1 | 33.9 | 0.8584071 | 1.0943953 |
| Scape | 26.1 | 38.6 | 35.2 | 0.74147725 | 1.0965909 |
| Brain | 16.9 | 49.2 | 33.8 | 0.5 | 1.4556212 |
| Crop | 16.3 | 42.6 | 41.1 | 0.39659366 | 1.0364964 |
| Eye | 51.6 | 22.5 | 25.8 | 2 | 0.872093 |
| Intestine | 36.8 | 23 | 40.2 | 0.91542286 | 0.5721393 |
| Leg, front | 33.8 | 40.8 | 25.3 | 1.3359684 | 1.6126482 |
| Leg, middle | 32.5 | 39.9 | 27.6 | 1.1775362 | 1.4456521 |
| Leg, rear | 40.1 | 41.4 | 18.5 | 2.1675675 | 2.2378378 |
| Mandibular gland | 22 | 49.3 | 28.6 | 0.7692308 | 1.7237762 |
| Rectum | 13.1 | 49.4 | 37.5 | 0.34933335 | 1.3173333 |
| Salivary gland, cerebral | 71.7 | 20 | 8.3 | 8.638555 | 2.4096386 |
| Salivary gland, thoracic | 46.5 | 20.5 | 33 | 1.4090909 | 0.6212121 |
| Sternite | 23.2 | 34.8 | 42 | 0.552381 | 0.82857144 |
| Tergite | 19.5 | 50.1 | 30.3 | 0.64356434 | 1.6534654 |
| Ventriculus | 30.3 | 48.4 | 21.2 | 1.4292452 | 2.2830188 |
| Thoracic muscle | 2.8* | 53.6 | 43.6 | 0.06422018 | 1.2293578 |
| Fat body | 12.7 | 50.7 | 36.6 | 0.34699455 | 1.3852459 |
| Malpighian tubules | 34.9 | 26.4 | 38.7 | 0.9018088 | 0.68217057 |
| Nerve chord | 23.1 | 30.3 | 46.7 | 0.49464667 | 0.64882225 |
| Poison sac | |||||
| Sting | 73.8* | 26.2 | 2.816794 | ||
| Heart | 16.9 | 44.6 | 38.5 | 0.43896103 | 1.1584415 |
| Hypopharyngeal gland | 70.7 | 29.3 | 2.4129694 | ||
| Galea | 30 | 38.4 | 31.6 | 0.9493671 | 1.2151898 |
| Glossa | 30.4 | 32.8 | 36.7 | 0.82833785 | 0.89373296 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 28.7 | 41.2 | 32.4 | 0.88580245 | 1.2716049 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAATNAIKRLIPLFDRVLVQRAEAITKTKGGIVLPEKAQAKVLQGTVVAIGPGQRNDKGE HIPLSIKVGDIVLLPEYGGTKVEFEDNKEFHLFRESDILAKLEV |
 Top
| |