| Protein: 328777933 XP_393351.3 PREDICTED: nucleoside diphosphate kinase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 42.2 | 31 | 26.9 | 1.5687733 | 1.1524163 |
| Scape | 30.5 | 38.8 | 30.7 | 0.99348533 | 1.2638437 |
| Brain | 43.5 | 56.5 | 0.7699115 | ||
| Crop | 43.2 | 21.8 | 34.9 | 1.2378223 | 0.62464184 |
| Eye | 59.2 | 13.7 | 27 | 2.1925926 | 0.5074074 |
| Intestine | 3.6* | 40.2 | 56.2 | 0.06405694 | 0.71530247 |
| Leg, front | 41.2 | 24.6 | 34.2 | 1.2046784 | 0.71929824 |
| Leg, middle | 41.7 | 27 | 31.3 | 1.3322684 | 0.8626198 |
| Leg, rear | 49.5 | 19.4 | 31.1 | 1.5916399 | 0.6237942 |
| Mandibular gland | 27.7 | 18.5 | 53.7 | 0.51582867 | 0.34450653 |
| Rectum | 46 | 20.1 | 34 | 1.3529412 | 0.59117645 |
| Salivary gland, cerebral | 51.8 | 24.3 | 23.9 | 2.1673641 | 1.0167364 |
| Salivary gland, thoracic | 39.3 | 28.4 | 32.3 | 1.2167183 | 0.87925696 |
| Sternite | 33.7 | 32.6 | 33.6 | 1.0029762 | 0.9702381 |
| Tergite | 37.2 | 24.6 | 38.2 | 0.973822 | 0.6439791 |
| Ventriculus | 9.5 | 50.3 | 40.3 | 0.235732 | 1.2481389 |
| Thoracic muscle | 34.4 | 43.8 | 21.9 | 1.5707762 | 2 |
| Fat body | 39.4 | 30.7 | 30 | 1.3133334 | 1.0233333 |
| Malpighian tubules | 43.6 | 22.3 | 34.1 | 1.2785923 | 0.6539589 |
| Nerve chord | 24.9 | 33.6 | 41.5 | 0.6 | 0.80963856 |
| Poison sac | |||||
| Sting | 55.4 | 44.6 | 1.2421525 | ||
| Heart | 38.9 | 25.7 | 35.4 | 1.09887 | 0.7259887 |
| Hypopharyngeal gland | 39.9 | 60.1 | 0.6638935 | ||
| Galea | 29.6 | 30.8 | 39.6 | 0.74747473 | 0.7777778 |
| Glossa | 24.9 | 33.8 | 41.3 | 0.6029056 | 0.81840193 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36 | 31 | 37.3 | 0.96514744 | 0.8310992 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVLCSTLVLLHLFSKLIMAENKERTFIMIKPDGVQRGLVGKIIQRFEEKGFKLVAMKMLW PTEELLKKHYSDLASRPFFPGLIKYMSSGPVVPMVWEGLNAVKTGRYMLGETNPKDSAPG TIRGDFCIQVGRNIIHGSDSVESANKEINLWFGEEKEVIDWTSWAEKWIYE |
 Top
| |