| Protein: 48097100 XP_391843.1 PREDICTED: 3-ketoacyl-CoA thiolase mitochondrial-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 27.2 | 40.7 | 32.1 | 0.847352 | 1.2679127 |
| Scape | 20.7 | 53.6 | 25.7 | 0.80544746 | 2.085603 |
| Brain | 23.2 | 65.9* | 10.8 | 2.148148 | 6.101852 |
| Crop | 24.8 | 45.3 | 29.9 | 0.8294314 | 1.5150502 |
| Eye | 14.9 | 56.6 | 28.5 | 0.522807 | 1.9859649 |
| Intestine | 34.2 | 37.2 | 28.6 | 1.1958042 | 1.3006994 |
| Leg, front | 41.2* | 39.1 | 19.7 | 2.0913706 | 1.9847716 |
| Leg, middle | 37.2 | 41.8 | 21 | 1.7714286 | 1.9904761 |
| Leg, rear | 66.7 | 19.8 | 13.5 | 4.9407406 | 1.4666667 |
| Mandibular gland | 5.7 | 85.4* | 8.9 | 0.64044946 | 9.595506 |
| Rectum | 15.1 | 63.7 | 21.1 | 0.7156398 | 3.0189574 |
| Salivary gland, cerebral | 96.3* | 2.2 | 1.4 | 68.78571 | 1.5714285 |
| Salivary gland, thoracic | 22.5 | 39.3 | 38.1 | 0.5905512 | 1.031496 |
| Sternite | 18 | 42.1 | 39.8 | 0.4522613 | 1.057789 |
| Tergite | 3.4 | 64.4 | 32.2 | 0.10559006 | 2 |
| Ventriculus | 40.6 | 24.8 | 34.6 | 1.1734104 | 0.716763 |
| Thoracic muscle | 33.2 | 66.8 | 0.497006 | ||
| Fat body | 23.4 | 25.1 | 51.5 | 0.45436892 | 0.48737863 |
| Malpighian tubules | 32.9 | 34 | 33 | 0.9969697 | 1.030303 |
| Nerve chord | 28.2 | 49.9 | 21.9 | 1.2876712 | 2.2785387 |
| Poison sac | |||||
| Sting | 39.3 | 60.7 | 0.64744645 | ||
| Heart | 11.9 | 44.4 | 43.7 | 0.2723112 | 1.0160183 |
| Hypopharyngeal gland | 91.8 | 8.2 | 11.195122 | ||
| Galea | 33.1 | 33.1 | 33.8 | 0.97928995 | 0.97928995 |
| Glossa | 22.4 | 28.6 | 48.9 | 0.4580777 | 0.58486706 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.4 | 44.5 | 30.2 | 0.9735099 | 1.4735099 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSLVTKGIFIVAAKRTPFGSFGGKFMNKNATDLSVIAAKSALQSAKLNPEKVDNVIFGHV LPISSSDGGFLTRHVALKSGIPLEKPSFSLNRLCGSGFQSIVSGAQSILLGESKIVLTGG VENMSQVPFSVRNIRFGTSLGQKYQFEDSLWLGFSDTYCNLSMGETAEKLGSQYNLKRQE VDEFALRSQQLWKAANDAGRFNEEIAPVTITVKKQDIVVNTDEHPRPQTTLQNLSKLPSI FKKDGLVTAGSSSGISDGAGVIILASEEVIKTEQLTPLARLVGYSVVGVEPSIMGIGPVP AIQKLLKITNKTLNDIELIEINEAFGSQTLACVKELKLDINKLNVDGGSIALGHPLAASG SRITAHLVHELRRRKTGSLGIGSACIGGGQGIALMIEAL |
 Top
| |