| Protein: 166795901 NP_001107670.1 apolipophorin-III-like protein |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 19.2 | 47.9 | 32.9 | 0.58358663 | 1.455927 |
| Scape | 20.7 | 37.7 | 41.6 | 0.49759614 | 0.90625 |
| Brain | 74* | 26 | 2.8461537 | ||
| Crop | 23 | 34.4 | 42.6 | 0.5399061 | 0.80751175 |
| Eye | |||||
| Intestine | 2.6* | 54.5 | 42.9 | 0.060606062 | 1.2703962 |
| Leg, front | 11.7* | 34.5 | 53.9 | 0.21706864 | 0.6400742 |
| Leg, middle | 5* | 40.9 | 54.1 | 0.09242144 | 0.7560074 |
| Leg, rear | 6.3* | 17.5* | 76.1 | 0.08278581 | 0.22996058 |
| Mandibular gland | 2* | 7 | 90.9 | 0.0220022 | 0.0770077 |
| Rectum | 2.3 | 32.2 | 65.4 | 0.035168197 | 0.49235475 |
| Salivary gland, cerebral | 12.8 | 40.7 | 46.5 | 0.27526882 | 0.8752688 |
| Salivary gland, thoracic | 10.1* | 48.3 | 41.7 | 0.24220623 | 1.1582733 |
| Sternite | 4.5* | 15.8* | 79.7 | 0.056461733 | 0.19824341 |
| Tergite | 2.1 | 10.4* | 87.5 | 0.024 | 0.11885715 |
| Ventriculus | |||||
| Thoracic muscle | 11.4 | 78.6 | 10 | 1.14 | 7.86 |
| Fat body | 12.7 | 24.5 | 62.7 | 0.20255183 | 0.3907496 |
| Malpighian tubules | 11.6* | 20.1* | 68.3 | 0.16983895 | 0.2942899 |
| Nerve chord | 6* | 64.3 | 29.6 | 0.2027027 | 2.1722972 |
| Poison sac | |||||
| Sting | 14.9 | 85.1 | 0.17508814 | ||
| Heart | 3.9* | 23.8 | 72.2 | 0.05401662 | 0.32963988 |
| Hypopharyngeal gland | 24.8 | 75.2 | 0.32978722 | ||
| Galea | 3.6* | 15.4* | 81 | 0.044444446 | 0.19012345 |
| Glossa | 5.9* | 17.3 | 76.8 | 0.076822914 | 0.22526042 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 8.9 | 33.9 | 58.4 | 0.15239726 | 0.58047944 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKIILTIIFSIILISEAKVAPTSTTNSQGTPDVQLSELISQAQANINNLAKQIQEQWNIP DQDTIVKTVKDQSANFVNNIQDYIKNVTEEVKTKTPELERSWNDVKTMLNKVVDDISSGI PNAQQQVAELQSKFQQGVQTLLKESDKAAKSLSQHSGKIQEDLAKFTKQAVDIAVQATQN LNNQLQTAATQKS |
 Top
| |