Home List proteins by tissue Protein search Downloads Links
Protein: 328776272 XP_003249139.1 PREDICTED: sulfide:quinone oxidoreductase mitochondrial-like
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 12.6* 57 30.4 0.41447368 1.875
Scape 18.4 47.6 34 0.5411765 1.4
Brain
Crop 28.2 42.2 29.6 0.9527027 1.4256756
Eye 76.3 23.7 3.2194092
Intestine 34.9 23.9 41.2 0.8470874 0.5800971
Leg, front 25.8 51.4 22.8 1.1315789 2.254386
Leg, middle 34.4 42.1 23.5 1.4638298 1.7914894
Leg, rear 72.9 27.1 2.690037
Mandibular gland
Rectum 45.6 54.4 0.8382353
Salivary gland, cerebral 44.5 4.3 51.2 0.8691406 0.083984375
Salivary gland, thoracic 17.6 58.9 23.4 0.75213677 2.5170941
Sternite 16.1 25.1 58.8 0.27380952 0.42687073
Tergite 39.5 37.6 22.9 1.7248908 1.6419214
Ventriculus
Thoracic muscle 9.5 86.7 3.8 2.5 22.81579
Fat body 26.7 40.7 32.6 0.8190184 1.2484663
Malpighian tubules 56.5* 24.9 18.6 3.0376344 1.3387097
Nerve chord 7.5* 62.3 30.2 0.24834438 2.062914
Poison sac
Sting 63.1 36.9 1.7100271
Heart 24.7 33.8 41.4 0.59661835 0.81642514
Hypopharyngeal gland 76.2 23.8 3.2016807
Galea 65.1 34.9 1.8653295
Glossa 69.2 30.8 2.2467532
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 29.9 49.8 31.6 0.9462025 1.5759493
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MSHIRNLRSTISCLKIYNLKLFERHILIKNKYRNVHHSCKLLVVGGGTGGCSMAAKFVDK
FKGQNQIIIIEPNEIHYYQPMFTLIGGGIRSFEDSKKPMKDTLPKNAKWFQDNVMSFEPT
QNQVTMSNGDTVQYEIMIVAMGLQLYWEKIPGLVESLKNNMSGVCSIYGSDTVTNVFPKI
TKIKDGTAIFTFPNSPVKCPGAPQKIAYIAEEYFQRQNVRDNIKVVYNTALPVIFGVKKY
ADALWDVCKKRNITVNVQTNLVKINPATEEAVFQKLDGSNETFVEKFSLLHVCPPMGPPD
VLKRHPSLTNEVGFLSVDPKTLRHTKYSNIYGIGDCISAPNSKTMAAIAAQGKVLYKNIT
DDLAGKPMTMIYNGYSSCPLVTGYKKCILAEFDYNLQPLETFPVNQGREYFFTFILKAYI
FPLLYWTLMTRGKWDGPEFLRKYSEIIKRKEVKN

Top