| Protein: 48096664 XP_394745.1 PREDICTED: putative acyl-CoA-binding protein-like isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 37.9 | 25.7 | 36.5 | 1.0383562 | 0.7041096 |
| Scape | 11.6* | 51.6 | 36.8 | 0.3152174 | 1.4021739 |
| Brain | 89* | 11 | 8.090909 | ||
| Crop | 56.1 | 21 | 23 | 2.4391305 | 0.9130435 |
| Eye | 87.7* | 12.3 | 7.130081 | ||
| Intestine | 46.1 | 35.5 | 18.4 | 2.5054348 | 1.9293479 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | 58 | 19.3 | 22.7 | 2.555066 | 0.85022026 |
| Mandibular gland | 3 | 82.4 | 14.6 | 0.20547946 | 5.6438355 |
| Rectum | 35.5 | 64.5 | 0.5503876 | ||
| Salivary gland, cerebral | 72.3 | 23.2* | 4.5 | 16.066668 | 5.1555557 |
| Salivary gland, thoracic | 15.4* | 46.5 | 38 | 0.40526316 | 1.2236842 |
| Sternite | 9.4 | 53.5 | 37.2 | 0.25268817 | 1.4381721 |
| Tergite | 2.2 | 90.1* | 7.8 | 0.2820513 | 11.551282 |
| Ventriculus | |||||
| Thoracic muscle | 78.2 | 21.8 | 3.587156 | ||
| Fat body | 28.3 | 48.3 | 23.4 | 1.2094017 | 2.0641026 |
| Malpighian tubules | 53.8* | 22.8 | 23.4 | 2.2991452 | 0.974359 |
| Nerve chord | 4.9* | 55.6 | 39.6 | 0.12373737 | 1.4040405 |
| Poison sac | |||||
| Sting | 46.3 | 53.7 | 0.8621974 | ||
| Heart | 12 | 70.7* | 17.3 | 0.6936416 | 4.086705 |
| Hypopharyngeal gland | 79.7 | 20.3 | 3.9261084 | ||
| Galea | 17.2 | 35.5 | 47.3 | 0.36363637 | 0.7505285 |
| Glossa | 12 | 55.5 | 32.5 | 0.36923078 | 1.7076923 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.8 | 50.1 | 27.6 | 1.2246376 | 1.8152174 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTLDEKFKKAAEEVKELSAPASDADLLELYSLYKQATIGDCNTSKPGMLDFKGKAKWDAW DKRKGMSQDAAKEQYIHKVEELISIIGKK |
 Top
| |