| Protein: 48142673 XP_393603.1 PREDICTED: thioredoxin mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 28.4 | 43.9 | 27.7 | 1.0252707 | 1.5848376 |
| Scape | 32.7 | 48.4 | 18.9 | 1.7301587 | 2.5608466 |
| Brain | 62.1 | 37.9 | 1.6385224 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 47.1 | 27.9 | 25 | 1.884 | 1.116 |
| Leg, front | 35.6 | 32.9 | 31.6 | 1.1265823 | 1.0411392 |
| Leg, middle | 29.1 | 45 | 26 | 1.1192307 | 1.7307693 |
| Leg, rear | 25.9 | 38.4 | 35.6 | 0.7275281 | 1.0786517 |
| Mandibular gland | 23.3 | 76.7 | 0.30378097 | ||
| Rectum | |||||
| Salivary gland, cerebral | 64.5 | 15.1 | 20.5 | 3.1463416 | 0.7365854 |
| Salivary gland, thoracic | 12 | 64.9* | 23.1 | 0.5194805 | 2.8095238 |
| Sternite | 35.1 | 36.5 | 28.4 | 1.2359155 | 1.2852113 |
| Tergite | 35.3 | 39.1 | 25.6 | 1.3789062 | 1.5273438 |
| Ventriculus | |||||
| Thoracic muscle | 1.8* | 98.2 | 0.018329939 | ||
| Fat body | |||||
| Malpighian tubules | 23.5 | 49.6 | 26.9 | 0.87360597 | 1.8438662 |
| Nerve chord | 28.3 | 47.5 | 24.2 | 1.1694214 | 1.9628099 |
| Poison sac | |||||
| Sting | |||||
| Heart | 47.4 | 23.4 | 29.1 | 1.628866 | 0.8041237 |
| Hypopharyngeal gland | 77.2 | 22.8 | 3.3859649 | ||
| Galea | 29.2 | 37 | 33.7 | 0.86646885 | 1.0979228 |
| Glossa | 22.5 | 35.1 | 42.5 | 0.5294118 | 0.8258824 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 30.7 | 42.6 | 34.4 | 0.89244187 | 1.2383721 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLRIGLRVIRTAIGSRAFANAPAQEQAISTTFKVQDPKDFNNRVKNSKVPVIVDFFATWC NPCRMLTPRIESVIAEKQGKVLLAKVDIDENSDLALDYEVGSVPVLIAMKDGKVLDRIVG LQDVDKLKQFVDKYSE |
 Top
| |