| Protein: 328783160 XP_397306.3 PREDICTED: transaldolase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.3 | 40.5 | 29.2 | 1.0376712 | 1.3869863 |
| Scape | 24.4 | 46.6 | 29 | 0.8413793 | 1.6068965 |
| Brain | 18 | 57.8 | 24.2 | 0.74380165 | 2.3884296 |
| Crop | 26 | 47.6 | 26.4 | 0.9848485 | 1.8030303 |
| Eye | 38.9 | 61.1 | 0.63666123 | ||
| Intestine | 46.1 | 33.2 | 20.7 | 2.2270532 | 1.6038648 |
| Leg, front | 37.5 | 40.1 | 22.3 | 1.6816144 | 1.7982063 |
| Leg, middle | 31.8 | 44.1 | 24.1 | 1.3195021 | 1.8298755 |
| Leg, rear | 67.8 | 21.3 | 10.9 | 6.2201834 | 1.9541284 |
| Mandibular gland | 4.8 | 78 | 17.3 | 0.27745664 | 4.5086703 |
| Rectum | 20.6 | 60.8 | 18.7 | 1.1016042 | 3.2513368 |
| Salivary gland, cerebral | 89.9 | 4.7 | 5.4 | 16.648148 | 0.8703704 |
| Salivary gland, thoracic | 35.3 | 24.9 | 39.8 | 0.8869347 | 0.6256281 |
| Sternite | 12.3 | 40.2 | 47.5 | 0.25894737 | 0.8463158 |
| Tergite | 3.7 | 71 | 25.3 | 0.14624506 | 2.806324 |
| Ventriculus | 16.9 | 49.4 | 33.6 | 0.5029762 | 1.4702381 |
| Thoracic muscle | |||||
| Fat body | 18.6 | 30.6 | 50.8 | 0.36614174 | 0.6023622 |
| Malpighian tubules | 36.8 | 43.3 | 19.9 | 1.8492463 | 2.1758795 |
| Nerve chord | 14.5 | 70.5 | 15 | 0.96666664 | 4.7 |
| Poison sac | |||||
| Sting | 57.1 | 42.9 | 1.3310024 | ||
| Heart | 10.5 | 61.7 | 27.8 | 0.37769786 | 2.2194245 |
| Hypopharyngeal gland | 59.9 | 40.1 | 1.4937656 | ||
| Galea | 41.4 | 58.6 | 0.7064846 | ||
| Glossa | 19.2 | 39.9 | 40.9 | 0.46943766 | 0.9755501 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 28.3 | 46 | 30.5 | 0.92786884 | 1.5081967 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSEPQSKKVKMTSSLTRLKEITTIVADTGDFQAMEQFKPIDATTNPSLILAAANQKKYIH LIDKAVQYGKKSGSTLTEQIEAALDITCVLFGKEILNIIPGRVSTEVDARLSFNKDASIE KAKKLIALYEELGVNKDRVLIKLASTWEGIQAAKELEEKYGIHCNLTLLFSFPQAVACAE AGVTLISPFVGRILDWYVANTDKKSYESKEDPGVLSVTKIYNYYKKFGYKTVVMGASFRN IGEIKELAGCDFLTISPKLLEELEKSNDVVRKVLTIEAAKKSDLQKISLNEAEFRWLMNE DQMATDKLSEGIRKFAVDVRKLEKLLQEKIQS |
 Top
| |