| Protein: 226533687 NP_001152775.1 venom serine carboxypeptidase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 25.6 | 45.5 | 28.9 | 0.8858132 | 1.5743945 |
| Scape | 25.1 | 60.3* | 14.7 | 1.7074829 | 4.102041 |
| Brain | 72.2* | 27.8 | 2.5971222 | ||
| Crop | 19.3 | 44 | 36.7 | 0.5258856 | 1.1989101 |
| Eye | 76.4 | 23.6 | 3.2372882 | ||
| Intestine | 27.8 | 36.2 | 36 | 0.7722222 | 1.0055555 |
| Leg, front | 29.8 | 54.1* | 16.1 | 1.8509316 | 3.3602486 |
| Leg, middle | 67.7 | 32.3 | 2.0959752 | ||
| Leg, rear | 25.1 | 57.4* | 17.4 | 1.4425287 | 3.2988505 |
| Mandibular gland | 5.4 | 62 | 32.6 | 0.16564417 | 1.9018404 |
| Rectum | 11.7 | 88.3 | 0.13250282 | ||
| Salivary gland, cerebral | 73.1 | 0.4* | 26.4 | 2.7689395 | 0.015151515 |
| Salivary gland, thoracic | 2.9* | 77.8* | 19.3 | 0.15025906 | 4.031088 |
| Sternite | 15.6 | 38.1 | 46.3 | 0.33693305 | 0.82289416 |
| Tergite | 4.5 | 56.1 | 39.4 | 0.1142132 | 1.4238579 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 17.9 | 54 | 28 | 0.63928574 | 1.9285715 |
| Malpighian tubules | 31.8 | 15.3* | 52.9 | 0.60113424 | 0.28922495 |
| Nerve chord | 19.2 | 53.7 | 27.1 | 0.7084871 | 1.9815499 |
| Poison sac | 46.5 | 53.5 | 0.86915886 | ||
| Sting | 64.9 | 35.1 | 1.8490028 | ||
| Heart | 31.1 | 42.9 | 26 | 1.1961539 | 1.65 |
| Hypopharyngeal gland | 63.2 | 36.8 | 1.7173913 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 26 | 50.6 | 33.9 | 0.76696163 | 1.4926254 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MKKLVLLQFLFFISFARGFTNVYPKPKYCPLLHEEDAGIPLFLTPLIENGKIDEARNKAV IQHKEVEAISSYAGFLTVNKKYNSNMFFWFFPALHDPKTAPVVLWLQGGPGATSMYGLFL ENGPFIVTKNKTLKMREYSWNKCHNLLYIDNPVGTGFSFTEDERGYATNETHVGRDVHTA LVQFFELFPELQTNDFYVTGESYGGKYVPAVSHAIKDYNIKAKIKINLKGLAIGNGLTDP VNQLDYGDYLYQLGLLDANGRNLFQKYEEQGKNLIKQEKWLEAFDLFDELLDGDITQQPS LYKNLTGFDYYFNYLHEKDPSNDSDYMVEWLQRADVRKAIHVGNRTFIPESKKVEKYMKA DVMQSLAVLIADLTQHYRVLIYNGQLDIIVAYPLTENYLQKLKWPGAEKYKTAQRKVWFV GNELAGYSKTVDSLTEVLVRNAGHMVPLDQPKWALDLITRFTHNKGF |
 Top
| |