| Protein: 328777241 XP_624870.2 PREDICTED: estradiol 17-beta-dehydrogenase 8-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 38.4 | 26 | 35.6 | 1.0786517 | 0.7303371 |
| Scape | 32.5 | 38.8 | 28.7 | 1.1324042 | 1.3519164 |
| Brain | 90.2* | 9.8 | 9.204082 | ||
| Crop | |||||
| Eye | |||||
| Intestine | 25.8 | 30.2 | 44 | 0.5863636 | 0.68636364 |
| Leg, front | 76.1 | 23.9 | 3.1841004 | ||
| Leg, middle | 55.8 | 44.2 | 1.2624434 | ||
| Leg, rear | 48.9 | 35.4 | 15.7 | 3.1146498 | 2.254777 |
| Mandibular gland | |||||
| Rectum | |||||
| Salivary gland, cerebral | 95.4* | 4.6 | 20.73913 | ||
| Salivary gland, thoracic | 6.8* | 66.4 | 26.8 | 0.25373134 | 2.477612 |
| Sternite | 80.4 | 19.6 | 4.102041 | ||
| Tergite | 77.1 | 22.9 | 3.3668122 | ||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 6.5 | 67.3 | 26.2 | 0.24809161 | 2.5687022 |
| Malpighian tubules | 25.4 | 46.3 | 28.2 | 0.9007092 | 1.6418439 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 57.9 | 42.1 | 1.375297 | ||
| Heart | 10.9 | 56.3 | 32.8 | 0.33231708 | 1.7164634 |
| Hypopharyngeal gland | 82.1 | 17.9 | 4.586592 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.6 | 59.3 | 26.5 | 1.3056604 | 2.2377357 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVAGKIAFVTGAGSGIGRKVCHILAKQGASVIATDINLKNAEETIRSLNDSRHLALNVEV LNEQSIKEAFKNVINKYSTPPTIIVNSAGITTVKEMINANVNKGGSIVNISSIIGKIGNM GQANYAASKAGVIALTKTASLEFGQFGIRVNTVLPGFIETPMTKTIPENIKQLFIKRIPL HRMGKPEEVAEVISFLASSKSSYINGASIDVTGGLY |
 Top
| |