| Protein: 328785946 XP_001121882.2 PREDICTED: ATP synthase-coupling factor 6 mitochondrial |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 11.9* | 39.1 | 49 | 0.24285714 | 0.7979592 |
| Scape | 13.4* | 13.3 | 73.2 | 0.18306011 | 0.18169399 |
| Brain | 37.4 | 23.1 | 39.5 | 0.94683546 | 0.58481014 |
| Crop | 25.1 | 10.4* | 64.5 | 0.38914728 | 0.16124031 |
| Eye | 52.5 | 47.5 | 1.1052631 | ||
| Intestine | 29.7 | 33.2 | 37.1 | 0.8005391 | 0.8948787 |
| Leg, front | 35.4 | 26.9 | 37.7 | 0.938992 | 0.71352786 |
| Leg, middle | 30.4 | 33.3 | 36.3 | 0.8374656 | 0.91735536 |
| Leg, rear | 33.3 | 17.9 | 48.7 | 0.6837782 | 0.36755648 |
| Mandibular gland | 4.7 | 53.8 | 41.6 | 0.11298077 | 1.2932693 |
| Rectum | 46.4 | 14.1 | 39.5 | 1.1746836 | 0.35696203 |
| Salivary gland, cerebral | 45.5 | 15.1 | 39.4 | 1.1548223 | 0.38324872 |
| Salivary gland, thoracic | 47.6 | 16.6 | 35.8 | 1.3296089 | 0.46368715 |
| Sternite | 20.2 | 24.9 | 54.9 | 0.3679417 | 0.45355192 |
| Tergite | 26.8 | 37.2 | 35.9 | 0.74651814 | 1.0362117 |
| Ventriculus | 20 | 80 | 0.25 | ||
| Thoracic muscle | 41.1 | 25.7 | 33.1 | 1.2416918 | 0.776435 |
| Fat body | |||||
| Malpighian tubules | 35.6 | 28 | 36.4 | 0.978022 | 0.7692308 |
| Nerve chord | 87.7* | 0.4* | 11.9 | 7.369748 | 0.033613443 |
| Poison sac | |||||
| Sting | |||||
| Heart | 61.9 | 12 | 26.1 | 2.3716476 | 0.4597701 |
| Hypopharyngeal gland | |||||
| Galea | 33.2 | 28.3 | 38.6 | 0.8601036 | 0.7331606 |
| Glossa | 29.1 | 30.8 | 40.1 | 0.7256858 | 0.7680798 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.7 | 24 | 43 | 0.83023256 | 0.55813956 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLFQQLTVSVPKIVKRNIGILAPAFQEAKDPIQKLFLDKIREYKAKSSGGKLVDVTPEIE KERQAELDRVKKQFNIKGDPTEFPKFKFQEPVVEQ |
 Top
| |