| Protein: 66557640 XP_624564.1 PREDICTED: phosphatidylinositol transfer protein alpha isoform |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 44.2 | 18.2 | 37.6 | 1.1755319 | 0.48404256 |
| Scape | 51.2 | 20.5 | 28.3 | 1.8091873 | 0.7243816 |
| Brain | 38.6 | 61.4 | 0.6286645 | ||
| Crop | 42.9 | 57.1 | 0.7513135 | ||
| Eye | |||||
| Intestine | 30.6 | 32 | 37.4 | 0.8181818 | 0.85561496 |
| Leg, front | 26.8 | 24.8 | 48.3 | 0.5548654 | 0.51345754 |
| Leg, middle | 28.1 | 20.9 | 51 | 0.5509804 | 0.40980393 |
| Leg, rear | 26.9 | 20.6 | 52.5 | 0.51238096 | 0.39238095 |
| Mandibular gland | 10.7 | 89.3 | 0.11982083 | ||
| Rectum | |||||
| Salivary gland, cerebral | 34 | 16 | 50 | 0.68 | 0.32 |
| Salivary gland, thoracic | 64.1* | 15 | 20.9 | 3.0669856 | 0.71770334 |
| Sternite | |||||
| Tergite | 36 | 64 | 0.5625 | ||
| Ventriculus | 57.6 | 42.4 | 1.3584906 | ||
| Thoracic muscle | |||||
| Fat body | 27.7 | 35.3 | 37 | 0.74864864 | 0.95405406 |
| Malpighian tubules | 31.3 | 32.3 | 36.4 | 0.8598901 | 0.88736266 |
| Nerve chord | 23.9 | 33 | 43.1 | 0.55452436 | 0.76566124 |
| Poison sac | |||||
| Sting | 34.7 | 65.3 | 0.5313936 | ||
| Heart | 35.2 | 27.6 | 37.3 | 0.9436997 | 0.73994637 |
| Hypopharyngeal gland | 47 | 53 | 0.8867925 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.4 | 30.7 | 48 | 0.6958333 | 0.63958335 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLIKEFRVTLPLNVKEYQVAQLYSVAEASKNNTGGGEGIQVLKNEPFTDYPLLGGKYSSG QYTYKIYHLASKVPAFIRIMLPKNSLEIHEEAWNAYPYCKTVITNPGYMKENFVIMIESF HIDDVGNQHNVHELPPDKLKIREVIHIDIANDPIANADYKEDEDPTKFKSVKTGRGPLIG KDWKNNVQPVMTCYKLVTCEFKWFGLQNRVESFIQKAERRLFTNFHRQVFCWIDRWYGLT MEDIRAIEESTKEELDRQRDQGEVRGMRADD |
 Top
| |