![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 66514614 XP_396769.2 PREDICTED: chitinase-like protein Idgf4-like |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 12.7 | 66* | 21.3 | 0.59624416 | 3.0985916 |
| Scape | 29.3 | 56.4* | 14.2 | 2.0633802 | 3.971831 |
| Brain | 82.7* | 17.3 | 4.780347 | ||
| Crop | 15.4 | 76.3* | 8.3 | 1.8554217 | 9.192771 |
| Eye | 18.1 | 63 | 18.9 | 0.95767194 | 3.3333333 |
| Intestine | 19.9 | 63.3* | 16.8 | 1.1845238 | 3.767857 |
| Leg, front | 17.9 | 61.4 | 20.7 | 0.8647343 | 2.9661837 |
| Leg, middle | 18 | 57.7 | 24.2 | 0.74380165 | 2.3842976 |
| Leg, rear | 20.1 | 56.5 | 23.4 | 0.85897434 | 2.4145298 |
| Mandibular gland | 14.4 | 52.2 | 33.4 | 0.4311377 | 1.5628742 |
| Rectum | 22.1 | 45.7 | 32.2 | 0.6863354 | 1.4192547 |
| Salivary gland, cerebral | 17.9 | 73.6* | 8.5 | 2.1058824 | 8.658824 |
| Salivary gland, thoracic | 10.7* | 53.4 | 35.8 | 0.2988827 | 1.4916201 |
| Sternite | 24 | 56.8 | 19.2 | 1.25 | 2.9583333 |
| Tergite | 26.8 | 35.8 | 37.4 | 0.71657753 | 0.95721924 |
| Ventriculus | |||||
| Thoracic muscle | 13.2* | 84.4* | 2.4 | 5.5 | 35.166668 |
| Fat body | 40.9 | 25.7 | 33.4 | 1.2245508 | 0.7694611 |
| Malpighian tubules | 36.5 | 32.8 | 30.7 | 1.188925 | 1.068404 |
| Nerve chord | 15.9 | 41.6 | 42.5 | 0.37411764 | 0.97882354 |
| Poison sac | 41.1 | 58.9 | 0.6977929 | ||
| Sting | 68.7 | 31.3 | 2.194888 | ||
| Heart | 23.7 | 45.9 | 30.4 | 0.77960527 | 1.5098684 |
| Hypopharyngeal gland | 83.2 | 16.8 | 4.952381 | ||
| Galea | 34.4 | 40.1 | 25.5 | 1.3490196 | 1.572549 |
| Glossa | 29.1 | 34.2 | 36.7 | 0.7929155 | 0.9318801 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 21.9 | 56 | 25.6 | 0.85546875 | 2.1875 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVTKMKVLIFAAVAVFCVQSVFTVDTHEHNKVVCYWNTTAFERQGPGKFQLDDVQSALSL CTHLIYGFAGINAETFEVVPLKPSLDTGVGYSYYKLVTQLKRTFPNLKIYLGIGGNADPD DETHKYLVLTETSQSRSKFINSVNRLLNDYDFDGIDLAWQFPPAKVKKERGTFGSIWHGI KKTFGYGKFKDDKEVEHRDGFTILVRDLKAQLRPRLKDLTIGVLPHVNSTVYYDARLLAP NIDAVHLFTFDQKTPERNPREGDYPAPIYESYGRVPQDNVDSTARYWLEHGTPGSKIVVG IPTYARTWKLTSESQISGVPPIVTDGPGAEGPHTNTPGLLSYAEVCSRLTESAVGRLRRV GDPSKKYGSYAYQPYNENTGADGIWVGYEDPDTAGNKAAYAKAKGLGGVAIYDLSLDDFR GVCTGDKYPIIRAAKYKL |
|
| |