| Protein: 58585172 NP_001011614.1 phospholipase A2 precursor |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 17.3* | 82.7 | 0.20918985 | ||
| Scape | |||||
| Brain | |||||
| Crop | 3.8* | 96.2 | 0.03950104 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 0.1* | 99.9 | 0.001001001 | ||
| Salivary gland, cerebral | 28.2 | 71.8 | 0.39275765 | ||
| Salivary gland, thoracic | |||||
| Sternite | 1.6* | 9.2* | 89.2 | 0.01793722 | 0.10313901 |
| Tergite | 1.2* | 0.4* | 98.4 | 0.012195122 | 0.004065041 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 0.4* | 1.5* | 98.1 | 0.004077472 | 0.01529052 |
| Malpighian tubules | 0.9* | 1.5* | 97.6 | 0.009221311 | 0.015368852 |
| Nerve chord | 0.3* | 0.1* | 99.6 | 0.003012048 | 0.001004016 |
| Poison sac | 0.4 | 99.6 | 0.004016064 | ||
| Sting | 0.3* | 99.7 | 0.003009027 | ||
| Heart | 1.4* | 1.1* | 97.5 | 0.014358974 | 0.011282051 |
| Hypopharyngeal gland | |||||
| Galea | 26.7 | 73.3 | 0.36425647 | ||
| Glossa | 1.5* | 46.4 | 52.1 | 0.028790787 | 0.890595 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 4 | 9.1 | 89.7 | 0.04459309 | 0.10144927 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MQVVLGSLFLLLLSTSHGWQIRDRIGDNELEERIIYPGTLWCGHGNKSSGPNELGRFKHT DACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDKFYDCLKNSADTISSYFVGKMY FNLIDTKCYKLEHPVTGCGERTEGRCLHYTVDKSKPKVYQWFDLRKY |
 Top
| |