| Protein: 58585170 NP_001011610.1 major royal jelly protein 4 precursor |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 2.8* | 5.3 | 91.8 | 0.030501088 | 0.057734206 |
| Brain | 18.2 | 81.8 | 0.22249389 | ||
| Crop | 7.1* | 22.9 | 70 | 0.10142857 | 0.32714286 |
| Eye | |||||
| Intestine | 11.8* | 88.2 | 0.13378684 | ||
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | 6.9 | 93.1 | 0.07411385 | ||
| Rectum | |||||
| Salivary gland, cerebral | 3.4* | 3 | 93.6 | 0.036324784 | 0.03205128 |
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 2.3* | 97.7 | 0.023541452 | ||
| Malpighian tubules | 26.4* | 73.6 | 0.35869566 | ||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | 0.4* | 99.6 | 0.004016064 | ||
| Galea | 1.7* | 1.6* | 96.7 | 0.017580144 | 0.016546018 |
| Glossa | 1.2* | 3.4* | 95.4 | 0.012578616 | 0.035639413 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 7.1 | 7.7 | 89.2 | 0.079596415 | 0.08632287 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTKWLLLMVCLGIACQNIRGGVVRENSSGKNLTNTLNVIHKWKYLDYDFDNDERRQAAIQ SGEYDRTKNYPLDVDQWHNKTFLAVIRYNGVPSSLNVVSDKTGNGGRLLQPYPDWSFAKY EDCSGIVSAHKIAIDEYERLWVLDSGLVNNTQPMCSPKLFAFDLNTSQLLKQVEIPHDVA TTGKGELVSLTVQAMDSTNTMVYMVDNKNTLIIYQNADDSFHRLSSHTLNHNSDKMSDQQ ENLTLKEVDNKVYGMALSPVTHNLYYNSPSSENLYYVNTESLMKSENQGNDVQYERVQDV FDSQLTVKAVSKNGVLLFGLANNTLSCWNEHQSLDRQNIDVVARNEDTLQMVVSMKIKQN VPQSGRVNNTQRNEYLLALSDRNQNVLNNDLNLEHVNFQILGANVNDLIRNSRCANFDNQ DNNHYNHNHNQARHSSKSDNQNNNQHNDQAHHSSKSNNRHNNND |
 Top
| |