| Protein: 66525576 XP_624353.1 PREDICTED: aldose reductase-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 28.9 | 38.8 | 32.3 | 0.8947368 | 1.2012384 |
| Scape | 24 | 50.4 | 25.6 | 0.9375 | 1.96875 |
| Brain | 38.9 | 34.4 | 26.7 | 1.4569288 | 1.2883896 |
| Crop | 9.8 | 67.9* | 22.3 | 0.4394619 | 3.044843 |
| Eye | 16.5 | 63.4 | 20.1 | 0.8208955 | 3.154229 |
| Intestine | 36 | 41.2 | 22.8 | 1.5789474 | 1.8070176 |
| Leg, front | 28.7 | 49.4 | 21.8 | 1.3165138 | 2.266055 |
| Leg, middle | 25.7 | 54.5 | 19.8 | 1.2979798 | 2.7525253 |
| Leg, rear | 53.5 | 29.7 | 16.8 | 3.1845238 | 1.7678572 |
| Mandibular gland | 23.3 | 56.8 | 19.9 | 1.1708543 | 2.8542714 |
| Rectum | 20.1 | 50.4 | 29.5 | 0.68135595 | 1.7084745 |
| Salivary gland, cerebral | 85.2 | 7.6 | 7.2 | 11.833333 | 1.0555556 |
| Salivary gland, thoracic | 16.2 | 50.9 | 33 | 0.4909091 | 1.5424242 |
| Sternite | 17.5 | 45.5 | 37 | 0.47297296 | 1.2297298 |
| Tergite | 7.2 | 73.5 | 19.2 | 0.375 | 3.828125 |
| Ventriculus | 45.4 | 34.7 | 19.9 | 2.281407 | 1.7437186 |
| Thoracic muscle | 17 | 69.2 | 13.8 | 1.231884 | 5.014493 |
| Fat body | 38.2 | 34.9 | 26.9 | 1.4200743 | 1.2973977 |
| Malpighian tubules | 29.6 | 33.9 | 36.5 | 0.8109589 | 0.92876714 |
| Nerve chord | 14.8 | 74* | 11.2 | 1.3214285 | 6.607143 |
| Poison sac | |||||
| Sting | 60.8 | 39.2 | 1.5510204 | ||
| Heart | 9.2 | 64.3 | 26.4 | 0.34848484 | 2.435606 |
| Hypopharyngeal gland | 79.1 | 20.9 | 3.784689 | ||
| Galea | 11.2 | 62.3 | 26.5 | 0.42264152 | 2.3509433 |
| Glossa | 15.6 | 58.5 | 25.8 | 0.60465115 | 2.2674417 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 26.6 | 51.5 | 24.1 | 1.1037345 | 2.1369295 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVANSAPTLKFYNGNEIPVFGLGTWKSKPGEVTQSVKDAIDIGYRHIDCAHVYGNEKEVG IAIKEKITQNIVKRQDLFITSKLWNTFHKPDLVESAIKTSLSDLGLEYLDLYLIHWPVAF KEGDDLFPQNPDGSPSFSDADYVDTWKAMESLVNKGLTKNIGISNFNSEQIERILKICTI KPVTNQIECHPYLTQKKLSKFCKDKDILITAYSPLGSPDRPWAKPDDPKLLDDKKLCEVA KKYNKTPAQILIRYQLDRGHIVIPKSVTRSRIAENYEVFDFKLSSEDIEYIDSFDCNGRI CPLSGSEASPHYPFHISF |
 Top
| |