| Protein: 328789760 XP_001120072.2 PREDICTED: cofilin/actin-depolymerizing factor homolog |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 34 | 34.3 | 31.7 | 1.0725552 | 1.082019 |
| Scape | 31.4 | 35.7 | 32.9 | 0.9544073 | 1.0851064 |
| Brain | 54.1 | 18.6 | 27.4 | 1.9744525 | 0.6788321 |
| Crop | 46.6 | 24 | 29.4 | 1.585034 | 0.81632656 |
| Eye | 2.4 | 65.6 | 32.1 | 0.07476635 | 2.0436137 |
| Intestine | 29.7 | 43.2 | 27.1 | 1.095941 | 1.594096 |
| Leg, front | 36.1 | 34.7 | 29.2 | 1.2363014 | 1.1883562 |
| Leg, middle | 34.3 | 34.6 | 31.1 | 1.102894 | 1.1125402 |
| Leg, rear | 28.8 | 41.3 | 29.9 | 0.9632107 | 1.3812709 |
| Mandibular gland | 50.6 | 7.7 | 41.6 | 1.2163461 | 0.18509616 |
| Rectum | 26.8 | 43.4 | 29.8 | 0.8993289 | 1.4563758 |
| Salivary gland, cerebral | 37.2 | 27.4 | 35.4 | 1.0508474 | 0.7740113 |
| Salivary gland, thoracic | 27.2 | 40.5 | 32.2 | 0.8447205 | 1.257764 |
| Sternite | 58.4* | 34.9 | 6.7 | 8.716418 | 5.2089553 |
| Tergite | 65 | 23.1 | 12 | 5.4166665 | 1.925 |
| Ventriculus | 19.1 | 44.9 | 35.9 | 0.53203344 | 1.2506964 |
| Thoracic muscle | 76.1 | 23.9 | 3.1841004 | ||
| Fat body | 76 | 13.9 | 10.1 | 7.5247526 | 1.3762376 |
| Malpighian tubules | 37.1 | 35.5 | 27.4 | 1.3540146 | 1.2956204 |
| Nerve chord | 38 | 39.3 | 22.8 | 1.6666666 | 1.7236842 |
| Poison sac | 5.8 | 94.2 | 0.061571125 | ||
| Sting | 55.7 | 44.3 | 1.2573364 | ||
| Heart | 41.3 | 29.4 | 29.3 | 1.4095563 | 1.003413 |
| Hypopharyngeal gland | 48 | 52 | 0.9230769 | ||
| Galea | 25.2 | 33.1 | 41.7 | 0.60431653 | 0.793765 |
| Glossa | 23.2 | 27 | 49.8 | 0.46586347 | 0.5421687 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 39.1 | 33.7 | 33.1 | 1.1812689 | 1.0181268 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MINQSRQKGKKKLVSPVERCFPANLRFLTASGVTVADVCKTTYEEIKKDKKHRYVIFYIK DEKQIDVEVIGPRDAAYDAFLEDLQKGGSGECRYGLFDFEYTHQCQGTSEASKKQKLFLM SWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASEEAVEEKLRATDRN |
 Top
| |