![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328783577 XP_001120866.2 PREDICTED: cysteine string protein |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 42.3 | 17.4 | 40.3 | 1.0496278 | 0.4317618 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 58.4 | 41.6 | 1.4038461 | ||
| Leg, front | 52.2 | 47.8 | 1.0920502 | ||
| Leg, middle | 51.1* | 25.9 | 23 | 2.221739 | 1.126087 |
| Leg, rear | 67.5 | 32.5 | 2.0769231 | ||
| Mandibular gland | |||||
| Rectum | 62.8 | 37.2 | 1.6881721 | ||
| Salivary gland, cerebral | 59.7 | 0.4* | 39.9 | 1.4962406 | 0.010025063 |
| Salivary gland, thoracic | 48.7 | 18.1 | 33.2 | 1.4668674 | 0.54518074 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 32.9 | 15.8 | 51.2 | 0.6425781 | 0.30859375 |
| Malpighian tubules | 35.4 | 28.2 | 36.4 | 0.97252744 | 0.77472526 |
| Nerve chord | 12.4 | 60.8 | 26.8 | 0.46268657 | 2.2686567 |
| Poison sac | |||||
| Sting | |||||
| Heart | 12.7 | 49 | 38.3 | 0.33159268 | 1.2793734 |
| Hypopharyngeal gland | 60.9 | 39.1 | 1.5575447 | ||
| Galea | |||||
| Glossa | 54.5 | 45.5 | 1.1978022 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 41.7 | 37.5 | 38.1 | 1.0944881 | 0.984252 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MDKRKMSTAGDSLYQILEIPKTATPEEIKRTYRKLALKYHPDKNPNNPEAAEKVNFNIIN INYIFFHLIKDSIYDNYGSLGLYVAEQFGEENVNAYFVVTSGWCKALFIFCSLITACYCC CCCCFCCNFCCGKFKPTPPEDSGAYHNLQRDQNPEANVVTNQPRGLVKEEESDDEAITAQ PQGGPQNNSTNQQPIFAMPPPPATVDENTNLNSGAERVIYTTAASTNPFIGANVGTTSSS ATKW |
|
| |