| Protein: 328791559 XP_003251593.1 PREDICTED: cytochrome b-c1 complex subunit 9-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 47.8* | 26.6 | 25.6 | 1.8671875 | 1.0390625 |
| Scape | 22.8 | 28.6 | 48.5 | 0.47010309 | 0.58969074 |
| Brain | 26.5 | 24.7 | 48.8 | 0.54303277 | 0.50614756 |
| Crop | |||||
| Eye | 15.3 | 49.3 | 35.4 | 0.43220338 | 1.3926554 |
| Intestine | 47.3 | 11.9* | 40.7 | 1.1621622 | 0.29238328 |
| Leg, front | 26.9 | 31.4 | 41.7 | 0.6450839 | 0.7529976 |
| Leg, middle | 30.3 | 44.9 | 24.8 | 1.2217742 | 1.8104838 |
| Leg, rear | 18.6 | 45.3 | 36 | 0.51666665 | 1.2583333 |
| Mandibular gland | 19.3 | 21.4 | 59.4 | 0.32491583 | 0.36026937 |
| Rectum | 61.3 | 38.7 | 1.5839794 | ||
| Salivary gland, cerebral | 8.5 | 26.1 | 65.4 | 0.12996942 | 0.39908257 |
| Salivary gland, thoracic | 39.1 | 33.9 | 27.1 | 1.4428045 | 1.2509226 |
| Sternite | 23.8 | 30.6 | 45.6 | 0.5219298 | 0.67105263 |
| Tergite | 17.2 | 30.9 | 52 | 0.33076924 | 0.5942308 |
| Ventriculus | |||||
| Thoracic muscle | 33.2 | 66.8 | 0.497006 | ||
| Fat body | 47.3 | 39 | 13.7 | 3.4525547 | 2.8467152 |
| Malpighian tubules | 37.6 | 41.5 | 20.9 | 1.799043 | 1.9856459 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | 40.9 | 59.1 | 0.69204736 | ||
| Heart | 27.7 | 31.3 | 41.1 | 0.67396593 | 0.76155716 |
| Hypopharyngeal gland | 89.3 | 10.7 | 8.345795 | ||
| Galea | 33.9 | 37.8 | 28.3 | 1.1978799 | 1.3356891 |
| Glossa | 38.6 | 34.2 | 27.3 | 1.4139194 | 1.2527473 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.6 | 37.2 | 39 | 0.7589744 | 0.95384616 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: | MANALYNFIFKRSSTFTIAIIASSFFFERAFDLISNEMFEQINKGKLWKDIKDQYENK |
 Top
| |