| Protein: 66564326 XP_393632.2 PREDICTED: plasma glutamate carboxypeptidase-like isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 25.1 | 39.1 | 35.8 | 0.70111734 | 1.0921788 |
| Brain | |||||
| Crop | 54.9 | 45.1 | 1.2172949 | ||
| Eye | |||||
| Intestine | 15.4 | 64* | 20.6 | 0.74757284 | 3.106796 |
| Leg, front | 74 | 26 | 2.8461537 | ||
| Leg, middle | 70.4 | 29.6 | 2.3783784 | ||
| Leg, rear | |||||
| Mandibular gland | 21.7 | 78.3 | 0.27713922 | ||
| Rectum | 11.1 | 6.8 | 82.1 | 0.13520098 | 0.082825825 |
| Salivary gland, cerebral | 31.4 | 7.3 | 61.3 | 0.5122349 | 0.11908646 |
| Salivary gland, thoracic | |||||
| Sternite | 36.7 | 63.3 | 0.57977885 | ||
| Tergite | 39 | 61 | 0.6393443 | ||
| Ventriculus | 59.4 | 28.1 | 12.5 | 4.752 | 2.248 |
| Thoracic muscle | |||||
| Fat body | 63.4 | 11.7 | 24.9 | 2.5461848 | 0.4698795 |
| Malpighian tubules | 31.8 | 23.2 | 44.9 | 0.7082405 | 0.5167038 |
| Nerve chord | 2.3* | 72 | 25.6 | 0.08984375 | 2.8125 |
| Poison sac | |||||
| Sting | 91.2* | 8.8 | 10.363636 | ||
| Heart | 34.8 | 28.8 | 36.4 | 0.95604396 | 0.7912088 |
| Hypopharyngeal gland | 1.8 | 98.2 | 0.018329939 | ||
| Galea | 46.1 | 53.9 | 0.85528755 | ||
| Glossa | 5.5* | 31.9 | 62.6 | 0.08785942 | 0.50958467 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.1 | 40.7 | 45.8 | 0.6353712 | 0.8886463 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLLSTKLLIVVWLLRLHSILAAVVVNRQVDNVSSCNLPEPLLKEIDSYEIIARAIMNEAL NGSFKGTTWTGLSYFTEKFGPRLSGSQPLERSIDYVLKESADYGLENVHGENVTVPFWVR GEESATLLSPRQMDIAILGLGTSIATPLPEGITAEAIVVNSFEELIDRKNEVPGKIVVYN QEFVSYGETVRYRTNGATEASKYGAVAALIRSVTPYSLYTPHTGHQSYGENVTKIPVASI TVEDATLLRAMANRNELIIINLKMQAVNLPPTISRNVVADFRGSTNPEKIVVVSGHIDSW DVGLGAMDDGGGAFISWYAVKLLKYLNYRPRRTVRLIMWTAEEMGYVGALDFIKNHKSEQ NNLQFVMESDSGTFTPLGIEYTGTDIVGCILERIMTLLSPMGNLTVRSPNQGPDISTWIN EGVPGGSLWNQDDKYFYYHHTKADTMLVENSDSLDKGTALFAAVAYILADLSIDLPRHK |
 Top
| |