| Protein: 328789054 XP_003251221.1 PREDICTED: histone H4-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 52.8 | 47.2 | 1.1186441 | ||
| Scape | 40.4 | 30.2 | 29.3 | 1.3788396 | 1.0307168 |
| Brain | |||||
| Crop | 55.9 | 44.1 | 1.2675737 | ||
| Eye | 34.8 | 65.2 | 0.5337423 | ||
| Intestine | |||||
| Leg, front | |||||
| Leg, middle | 9.7* | 90.3 | 0.10741971 | ||
| Leg, rear | |||||
| Mandibular gland | 59.7 | 40.3 | 1.4813895 | ||
| Rectum | 65.5 | 34.5 | 1.8985507 | ||
| Salivary gland, cerebral | 28.8 | 19.1 | 52.1 | 0.55278313 | 0.3666027 |
| Salivary gland, thoracic | 15.7* | 46 | 38.3 | 0.40992168 | 1.2010444 |
| Sternite | 1.6* | 34.2 | 64.2 | 0.024922118 | 0.53271025 |
| Tergite | 0.1* | 86.8 | 13.1 | 0.007633588 | 6.625954 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 66.6 | 27.4* | 6 | 11.1 | 4.5666666 |
| Malpighian tubules | 17.4* | 82.6 | 0.21065375 | ||
| Nerve chord | 94* | 1.2 | 4.7 | 20 | 0.25531915 |
| Poison sac | 8.2 | 91.8 | 0.089324616 | ||
| Sting | 85.3* | 14.7 | 5.802721 | ||
| Heart | 2.9 | 79.5* | 17.6 | 0.16477273 | 4.5170455 |
| Hypopharyngeal gland | 7.6 | 92.4 | 0.08225108 | ||
| Galea | 35.9 | 42.7 | 21.4 | 1.6775701 | 1.9953271 |
| Glossa | 34.2 | 39.2 | 26.6 | 1.2857143 | 1.4736842 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 34.3 | 39.9 | 43.8 | 0.783105 | 0.9109589 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MTGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK VFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG |
 Top
| |