| Protein: 48139441 XP_397008.1 PREDICTED: l-xylulose reductase |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 58 | 42 | 1.3809524 | ||
| Scape | 54.1 | 45.9 | 1.1786492 | ||
| Brain | 72.1* | 27.9 | 2.5842295 | ||
| Crop | 12.4* | 23.1 | 64.5 | 0.19224806 | 0.35813954 |
| Eye | |||||
| Intestine | 59.4 | 40.6 | 1.4630542 | ||
| Leg, front | 71.3 | 28.7 | 2.4843206 | ||
| Leg, middle | |||||
| Leg, rear | 69.9 | 14.3 | 15.8 | 4.424051 | 0.9050633 |
| Mandibular gland | |||||
| Rectum | 61.3 | 38.7 | 1.5839794 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 6.8* | 65.3 | 27.9 | 0.2437276 | 2.3405018 |
| Sternite | 9.5 | 62.6 | 27.9 | 0.3405018 | 2.2437277 |
| Tergite | 1.8 | 37.2 | 60.9 | 0.02955665 | 0.61083746 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 7.6 | 23.5 | 68.9 | 0.11030479 | 0.34107402 |
| Malpighian tubules | 27.4 | 41.3 | 31.3 | 0.87539935 | 1.3194888 |
| Nerve chord | 7.2 | 59.5 | 33.3 | 0.21621622 | 1.7867868 |
| Poison sac | |||||
| Sting | 20.4 | 79.6 | 0.2562814 | ||
| Heart | 3.5* | 30.8 | 65.8 | 0.05319149 | 0.4680851 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 24.1 | 45.4 | 43.7 | 0.5514874 | 1.0389016 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNINFVGKRILVTGAGRGIGKDLALRLSKYEGQVIALSKKKENLDKLCKEDPRIQFICVD LSDWNATRKAVESVLPIDLLVNNAGVAHLNSFFDATPEDFDLTFTVNVKAILNVSQIVAK NMIERKVGGSIVNISSQASQAALKDHVVYCASKGAVDMLSKTMALELGPYNIRVNTVNPT VILTEMGKLGWSDPKKARTMLDKIPLGRFGEVSEVVDAIVYLLSNHSSMINGITLPVDGG FLAT |
 Top
| |