| Protein: 66547758 XP_624249.1 PREDICTED: hypothetical protein LOC551861 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 53.3 | 46.7 | 1.1413276 | ||
| Scape | 42.5 | 57.5 | 0.73913044 | ||
| Brain | |||||
| Crop | 47.7 | 52.3 | 0.9120459 | ||
| Eye | |||||
| Intestine | |||||
| Leg, front | 31.5 | 20.9 | 47.5 | 0.6631579 | 0.44 |
| Leg, middle | 14.8* | 32 | 53.2 | 0.2781955 | 0.60150373 |
| Leg, rear | 14.9 | 20.4 | 64.6 | 0.23065016 | 0.31578946 |
| Mandibular gland | 8 | 66.7 | 25.4 | 0.31496063 | 2.6259842 |
| Rectum | 47.6 | 28.5 | 23.9 | 1.9916317 | 1.1924686 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 28.2 | 44.9 | 26.9 | 1.0483271 | 1.669145 |
| Sternite | 26.1 | 23.8 | 50.1 | 0.52095807 | 0.4750499 |
| Tergite | 33.4 | 34.9 | 31.7 | 1.0536277 | 1.1009464 |
| Ventriculus | |||||
| Thoracic muscle | 8.6 | 82.4 | 9 | 0.95555556 | 9.155556 |
| Fat body | |||||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | |||||
| Hypopharyngeal gland | |||||
| Galea | 28.8 | 39.5 | 31.8 | 0.9056604 | 1.2421384 |
| Glossa | 45.2 | 25.6 | 29.2 | 1.5479453 | 0.8767123 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 27.9 | 39.7 | 39.3 | 0.7099237 | 1.0101781 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSSLEAGPRPVQVSPLIKFSRWTFLLTGILYGAYHQKRLSKRENALREQELKEKPIRDAK LAEEKKKLLEAEAKMIEEWSGIKK |
 Top
| |