| Protein: 66547340 XP_396741.2 PREDICTED: 40S ribosomal protein S3a |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 52.1 | 47.9 | 1.0876827 | ||
| Scape | 41.4 | 27.1 | 31.5 | 1.3142858 | 0.86031747 |
| Brain | |||||
| Crop | 5.2* | 46.5 | 48.3 | 0.10766046 | 0.9627329 |
| Eye | 60.4 | 39.6 | 1.5252526 | ||
| Intestine | 10.9 | 57.7 | 31.3 | 0.34824282 | 1.8434504 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 8.4 | 91.6 | 0.09170306 | ||
| Salivary gland, cerebral | 80 | 3.6 | 16.5 | 4.848485 | 0.21818182 |
| Salivary gland, thoracic | 36 | 19.6 | 44.3 | 0.8126411 | 0.44243792 |
| Sternite | 27.7 | 46.6 | 25.7 | 1.077821 | 1.8132296 |
| Tergite | 52.9 | 39.6 | 7.6 | 6.9605265 | 5.2105265 |
| Ventriculus | |||||
| Thoracic muscle | 53.6 | 46.4 | 1.1551725 | ||
| Fat body | 30.5 | 41.1 | 28.4 | 1.0739436 | 1.4471831 |
| Malpighian tubules | 41.1 | 23.6 | 35.3 | 1.1643059 | 0.66855526 |
| Nerve chord | 52.1 | 12.7 | 35.3 | 1.4759207 | 0.35977337 |
| Poison sac | |||||
| Sting | 46 | 54 | 0.8518519 | ||
| Heart | 18.4 | 51.7 | 29.9 | 0.61538464 | 1.729097 |
| Hypopharyngeal gland | 9.7 | 90.3 | 0.10741971 | ||
| Galea | 38.3 | 24.7 | 37 | 1.0351351 | 0.66756755 |
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 35.5 | 35.2 | 41.2 | 0.86165047 | 0.8543689 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MAVGKNKGLSKGGKKGVKKKIVDPFTRKDWYDVKAPSMFTNRHVGKTLVNRTQGTKIASE GLKYRVFEVSLADLQNDGDAERSFRKFRLIAEDVQHRNVLTNFHGMDLTTDKLRSMVKKW QTLIEANVDVKTTDGYLLRVFCIGFTNKDQLSTRKTCYAQHAQVKKIRQKMVDTITNDVT KSDLKGVVSKLLPDATAKDIEKASQGIYPLHDVYIRKVKVLKKPRFELSKLLELHGDGAG SKSEEVGESGSKVDRPEGYEPPVQESV |
 Top
| |