| Protein: 110765226 XP_001120364.1 PREDICTED: 60S acidic ribosomal protein P2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 43.3 | 31.8 | 24.9 | 1.7389559 | 1.2771084 |
| Scape | 45.3 | 28.9 | 25.9 | 1.7490348 | 1.1158301 |
| Brain | 58.3 | 19.1 | 22.6 | 2.579646 | 0.84513277 |
| Crop | 31.3 | 30.2 | 38.6 | 0.81088084 | 0.78238344 |
| Eye | 20.6 | 32 | 47.4 | 0.43459916 | 0.6751055 |
| Intestine | 23.7 | 45.2 | 31.1 | 0.7620579 | 1.4533762 |
| Leg, front | 38.9 | 35.4 | 25.8 | 1.507752 | 1.3720931 |
| Leg, middle | 43.3 | 33.7 | 23.1 | 1.8744589 | 1.4588745 |
| Leg, rear | 29.2 | 44 | 26.8 | 1.0895523 | 1.641791 |
| Mandibular gland | 28.3 | 50.4 | 21.3 | 1.3286386 | 2.366197 |
| Rectum | 35 | 32.3 | 32.6 | 1.0736196 | 0.9907975 |
| Salivary gland, cerebral | 34.6 | 30.8 | 34.6 | 1 | 0.89017344 |
| Salivary gland, thoracic | 24.1 | 41.6 | 34.3 | 0.7026239 | 1.212828 |
| Sternite | 21.9 | 33.6 | 44.6 | 0.49103138 | 0.75336325 |
| Tergite | 22.5 | 55.3 | 22.2 | 1.0135136 | 2.4909909 |
| Ventriculus | 31.9 | 31.7 | 36.5 | 0.8739726 | 0.86849314 |
| Thoracic muscle | |||||
| Fat body | 44.9 | 40.1 | 14.9 | 3.0134227 | 2.6912751 |
| Malpighian tubules | 42.9 | 26.4 | 30.8 | 1.3928572 | 0.85714287 |
| Nerve chord | 41.8 | 25.9 | 32.3 | 1.2941177 | 0.8018576 |
| Poison sac | |||||
| Sting | 51.5 | 48.5 | 1.0618557 | ||
| Heart | 28.9 | 41.4 | 29.7 | 0.97306395 | 1.3939394 |
| Hypopharyngeal gland | 13.3 | 86.7 | 0.15340254 | ||
| Galea | 28.9 | 31.1 | 40 | 0.7225 | 0.7775 |
| Glossa | 26 | 43.4 | 30.7 | 0.8469055 | 1.4136808 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 33.9 | 35.4 | 33.6 | 1.0089285 | 1.0535715 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MRYVAAYLLAVLGGKTSPNQNDIEKILSSVGIETDGEKLKKVIAELNGKSIEELISQGME KLLSMPVGGGVAVSADAAPVGGTTAPAEEKKEEKKPAKEESESEDDDMGFGLFD |
 Top
| |