Home List proteins by tissue Protein search Downloads Links
Protein: 328779020 XP_001119959.2 PREDICTED: bleomycin hydrolase-like
Distribution (mouse over here
Sample of a protein distribution map.
for a definition map of the organs displayed below):
Drone Queen Worker











































































































































































































































The above diagram is generated from the following data:
(Organs are coloured according to percent relative expression - 100% = black, 0% = white)

Tissues Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Flagellum 39.8 28.2 32 1.24375 0.88125
Scape 23.3 30.9 45.8 0.50873363 0.6746725
Brain
Crop 28.9 71.1 0.40646976
Eye 64.9 35.1 1.8490028
Intestine 14 34.8 51.2 0.2734375 0.6796875
Leg, front 33.9 35.4 30.8 1.1006494 1.1493506
Leg, middle 55.4 44.6 1.2421525
Leg, rear 36.6 34.6 28.8 1.2708334 1.2013888
Mandibular gland 9.7 90.3 0.10741971
Rectum 52.5 47.5 1.1052631
Salivary gland, cerebral
Salivary gland, thoracic 47.3 18 34.7 1.3631124 0.518732
Sternite 63.1 14.7 22.2 2.8423424 0.6621622
Tergite 64 36 1.7777778
Ventriculus 49.9 50.1 0.996008
Thoracic muscle
Fat body 39.5 10 50.5 0.7821782 0.1980198
Malpighian tubules 13.9 62.4* 23.7 0.5864979 2.6329114
Nerve chord 22.5 60.1 17.5 1.2857143 3.4342856
Poison sac
Sting 65.6 34.4 1.9069767
Heart 16 31.3 52.8 0.3030303 0.592803
Hypopharyngeal gland 63.7 36.3 1.754821
Galea 57.4 42.6 1.3474178
Glossa 31.5 43.1 25.3 1.2450593 1.7035573
An asterisk (*) on D or Q values denote a significance difference from W (p<0.05).
Drone(D)% Queen(Q)% Worker(W)%     D/W         Q/W    
Whole Body Average 34 41.4 41.1 0.8272506 1.0072993
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their
whole body averages are significantly different (p<0.05) from each other.
Sequence: MVASAGILTSEILNQLRAKFYEDNRNTLAQNVCTRTNPLEVCVSRKVLQETQHVFTHKIA
TEGKPITNQKNSGRCWIFSTLNVIRSAFMKQYNLDEFEFSQAYLFFWDKIERCNYFLHNI
VKTAKRNEPVEGRLVSFLLHDPICDGGQWDMVVNLINRHGLVPKICFPESYNCESSSRMN
TILKSKLREYSKVLRDLVSHGATDEELEAQILEQMVVIYRIIGICLGIPSKTITWEYYDK
AKNYNCIGPISPVEFYEKYVKPYYNVDDKVCLVTDPRPSNPYGKLYTIDCLGNVWGGRLT
LYNNQPPELLMKLCAESIKQNEPVWFGCDVNKRLIAKQGIQDMRAYDFELMFGTDIQVNL
TKADRLLYGDSMMVHAMALTAVSIDNEGKIKQFRVENSWGDDQGQKGYLLLTADWFSEFV
FEAVIDRKLVPENVLDVFKQEPITLPAWDPMGTLAH

Top