![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 110755253 XP_392277.3 PREDICTED: fatty-acid amide hydrolase 2-like isoform 1 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 95.1* | 4.9 | 19.408163 | ||
| Brain | |||||
| Crop | 32.9 | 49.1* | 18.1 | 1.8176795 | 2.7127073 |
| Eye | |||||
| Intestine | 23.4 | 40.1 | 36.5 | 0.6410959 | 1.0986302 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 23.7 | 76.3 | 0.310616 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | 36.2 | 31.7 | 32.1 | 1.1277258 | 0.98753893 |
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 40.7 | 59.3 | 0.68634063 | ||
| Malpighian tubules | |||||
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 89.5* | 10.5 | 8.523809 | ||
| Hypopharyngeal gland | 10.8 | 89.2 | 0.12107623 | ||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29 | 51 | 40.9 | 0.7090465 | 1.2469437 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSTKHKNQNKMKTQRQVLNAIHRLIEFIARLIYMFIAFLKGPAESQPPIKDLILLHSATT LAFKIRNRQLMSEEIVQSYIDRIREIQPVLNCMVEDRFEDALKEAKMCDEFLKSQNAPSP QILAEKKPFFGVPFTTKDCIGVANMKQTAGLTVRKNIVSKYDAEVIRLMRDAGAIPLATT NVSELAMWWETSNCLYGTTKNPYNTRHIVGGSSGGEGCIQAAAGSPLGIGSDIGGSIRIP SYFNGIFGHKPSTGIVSNDGQYPSAQSEDQKRLLAIGPMCRYAQDLSPILKILADKNADI LRLNEKVDISKLKFYYMEDDGGQLLTSPVELEIKEAMRKVIRYLEKAYKVKVTKLNIRKL KKSTALWMANMSCKDEKDFTYELSNRNGHINLWWEFLKWTMFMSNHTLIALLTATFERFA VKHGSDQHTKLIQESRELYREFQDILGEDGVFLFPTHPTAAPLHHEPLVKAFNFSYTAII NVLGLPATACPLGLNKQGLPIGIQIVGGLHQDRLTIAVAEELERGFGGWVPPVIVA |
|
| |