| Protein: 328789193 XP_395535.3 PREDICTED: UTP--glucose-1-phosphate uridylyltransferase isoform 1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 24.9 | 28.4 | 46.7 | 0.53319055 | 0.6081371 |
| Scape | 30.4 | 32.6 | 37 | 0.8216216 | 0.8810811 |
| Brain | 65.1 | 34.9 | 1.8653295 | ||
| Crop | 37.8 | 21.8 | 40.4 | 0.93564355 | 0.53960395 |
| Eye | 78.5 | 21.5 | 3.6511629 | ||
| Intestine | 39.1 | 34.8 | 26.1 | 1.4980843 | 1.3333334 |
| Leg, front | 28.7 | 34.4 | 36.9 | 0.7777778 | 0.9322493 |
| Leg, middle | 37.3 | 31.4 | 31.3 | 1.1916933 | 1.0031949 |
| Leg, rear | 66.1 | 16.8 | 17.1 | 3.865497 | 0.98245615 |
| Mandibular gland | 85.9 | 14.1 | 6.0921984 | ||
| Rectum | 35.5 | 42.8 | 21.7 | 1.6359447 | 1.9723502 |
| Salivary gland, cerebral | 75.3 | 5.7 | 19 | 3.963158 | 0.3 |
| Salivary gland, thoracic | 20.8 | 50.4 | 28.7 | 0.72473866 | 1.7560976 |
| Sternite | 38.6 | 28.9 | 32.5 | 1.1876923 | 0.8892308 |
| Tergite | 37.1 | 32.2 | 30.6 | 1.2124183 | 1.0522876 |
| Ventriculus | |||||
| Thoracic muscle | 10.4 | 83 | 6.7 | 1.5522388 | 12.38806 |
| Fat body | 15.1 | 42.9 | 42 | 0.3595238 | 1.0214286 |
| Malpighian tubules | 32.3 | 43.8 | 23.9 | 1.3514644 | 1.832636 |
| Nerve chord | 26.6 | 34.8 | 38.6 | 0.68911916 | 0.9015544 |
| Poison sac | |||||
| Sting | 36.2 | 63.8 | 0.56739813 | ||
| Heart | 21.8 | 37.2 | 41 | 0.53170735 | 0.9073171 |
| Hypopharyngeal gland | 59.7 | 40.3 | 1.4813895 | ||
| Galea | 41.4 | 58.6 | 0.7064846 | ||
| Glossa | 32.2 | 26.6 | 41.1 | 0.783455 | 0.64720196 |
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 38.7 | 37.8 | 33.1 | 1.1691843 | 1.141994 |
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MLQVDDRKARGHQRSPSDTQAFRERTKRDALNELQHELEKLEATATGDIKEEIHRQFDGF THLFRRFLQEEGPSLEWDRIQKLPDDAIRDYNSLPTPEGEELKTLLSKLIVIKLNGGLGT SMGCHGPKSVIAVRNGLTFLDLTVQQIEYLNKTYNANVPLILMNSFNTDDDTQRIIRKYK GIDVNIQTFNQSCYPRINRDSLLPTAKHCDIADDIEAWYPPGHGDFYESFRNSGLLKKFI KEGREYCFISNIDNLGATVDFKILKLLLDKREASPLEFVMEVTDKTRADVKGGTLIKYED KLRLLEIAQVPKDHVDDFKSVKTFKFFNTNNLWIKLSAIERVLEKNSLNMEIIVNNKTFS NGSNIIQLETAVGAAMKSFEGSIGINVPRSRFLPVKKTSDLMLVMSNLYTLRNGSLVMSP QRMFPTTPLIKLGDNHFAKVKEFLTRFPAIPDLLELDHLTVSGDVTFGKGVTLKGTVIII ANHGERIDLPSGTILENKIVSGNLRILNH |
 Top
| |