| Protein: 48096676 XP_392498.1 PREDICTED: aminoacylase-1-like |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 47.6* | 31.6 | 20.8 | 2.2884614 | 1.5192307 |
| Scape | 36.1 | 26.7 | 37.3 | 0.9678284 | 0.7158177 |
| Brain | 47.3 | 23.2 | 29.5 | 1.6033899 | 0.7864407 |
| Crop | 47.2 | 31.2 | 21.6 | 2.1851852 | 1.4444444 |
| Eye | 30.7 | 69.3 | 0.44300145 | ||
| Intestine | 44.6* | 38.3 | 17.1 | 2.6081872 | 2.2397661 |
| Leg, front | 36.5 | 27.9 | 35.6 | 1.025281 | 0.78370786 |
| Leg, middle | 30.7 | 33.6 | 35.8 | 0.8575419 | 0.9385475 |
| Leg, rear | 50.9 | 20.3 | 28.7 | 1.7735192 | 0.70731705 |
| Mandibular gland | 58 | 42 | 1.3809524 | ||
| Rectum | 28 | 55.3 | 16.7 | 1.6766467 | 3.3113773 |
| Salivary gland, cerebral | 68.4 | 31.6 | 2.164557 | ||
| Salivary gland, thoracic | 28.8 | 24.3 | 46.9 | 0.6140725 | 0.5181237 |
| Sternite | 59.4 | 40.6 | 1.4630542 | ||
| Tergite | |||||
| Ventriculus | 46.1 | 30.1 | 23.8 | 1.9369748 | 1.2647059 |
| Thoracic muscle | |||||
| Fat body | 76.3 | 23.7 | 3.2194092 | ||
| Malpighian tubules | 18.6 | 46.8 | 34.7 | 0.5360231 | 1.3487031 |
| Nerve chord | 26.4 | 41.4 | 32.1 | 0.8224299 | 1.2897196 |
| Poison sac | |||||
| Sting | 36.5 | 63.5 | 0.5748032 | ||
| Heart | 27.1 | 35 | 37.9 | 0.71503955 | 0.92348284 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | 45.4 | 54.6 | 0.83150184 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 43.2 | 34 | 35.4 | 1.220339 | 0.96045196 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MSLSSQVQLDATAVENFREYLRIPSVQPNVNYDGCVAFLEKQAKSLDLPFKIYYVDPKKP IVVLTWIGIDPSIPTILLNSHMDVVPVFEDKWTYPPFDAHIDEKGNIYARGSQDMKCVGI QYLEAIRRMKLTGQRFKRTIHISFVPDEEIGGVLGMEDFVHTKDFQALNIGFALDEGVAS PEESFFMFYGERSIWHVVIECSGNPGHGSLLLDNTAGEKIRVIIDRFMDFRAKEKAKLED PKIQLGDITSINLTLLKGGVQPNVIPPCLTAIFDCRLDPSVDHNEFEAMIKKWCEEAGSD VTYSFEQKNPKVENTKLDDSNLFWIAFKKACDDLAIQLQIGIFPGGTDSRYIRQVGIPAI GFSPMNKTKILLHDHDEYLNKDIFLKGIEIYMKIIAAVANV |
 Top
| |