![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 328786758 XP_393694.4 PREDICTED: four and a half LIM domains protein 2 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | 52.3 | 18.6 | 29.1 | 1.7972509 | 0.63917524 |
| Brain | |||||
| Crop | 24.7 | 35.5 | 39.8 | 0.620603 | 0.8919598 |
| Eye | |||||
| Intestine | 54.6* | 28.6 | 16.8 | 3.25 | 1.7023809 |
| Leg, front | 27.2 | 8.7* | 64.1 | 0.42433697 | 0.13572542 |
| Leg, middle | 28.7 | 8.7* | 62.6 | 0.45846644 | 0.13897763 |
| Leg, rear | 59.5 | 11.8 | 28.7 | 2.0731707 | 0.41114983 |
| Mandibular gland | |||||
| Rectum | 62.1 | 4.5 | 33.4 | 1.8592814 | 0.13473053 |
| Salivary gland, cerebral | 36.5 | 13.3 | 50.2 | 0.7270916 | 0.26494023 |
| Salivary gland, thoracic | 8.2 | 71* | 20.8 | 0.39423078 | 3.4134614 |
| Sternite | 79.2* | 16.9 | 3.9 | 20.307692 | 4.3333335 |
| Tergite | 95.3* | 3.4 | 1.3 | 73.30769 | 2.6153846 |
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | 90.8* | 7.1 | 2.1 | 43.238094 | 3.3809524 |
| Malpighian tubules | 97* | 3 | 32.333332 | ||
| Nerve chord | 67.2 | 6.5 | 26.3 | 2.555133 | 0.24714829 |
| Poison sac | |||||
| Sting | 6.6* | 93.4 | 0.07066381 | ||
| Heart | 65.8* | 10.8 | 23.4 | 2.8119657 | 0.46153846 |
| Hypopharyngeal gland | |||||
| Galea | 56* | 28.6 | 15.4 | 3.6363637 | 1.8571428 |
| Glossa | 49.1 | 50.9 | 0.96463656 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 56.6 | 19.4 | 31.4 | 1.8025478 | 0.6178344 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNGVQRMPSDAFDAKGVLITDVEEGQPCLQCGDSCSGFSPHTWRKNCTSCKCPREAHDVC HEEWVSVRSRLGLKGEEFSCPATFDPRGKGLAWAPPGLPAHKVKEYFSMLPEKSVPRLGT PGERYRDRQLAFQLPKQDLARAYCRHLNPKHASSADDFMAARNEIALDIGSVQEVLERDV DCGACHTPLKYGTLAVSASKLGLLYHPACFRCTECKELLVDLAYCVHDDTLFCERHYAEQ LKPRCAACDELIFSGEYTKAMSKDWHSGHFCCWQCDESLTGQRYVLRDEHPYCIKCYESV FANGCEECNKIIGIDSKDLSYKDKHWHEACFLCNRCRVSLVDKQFGSKVDKIYCGNCYDA QFASRCDGCGEIFRAGTKKMEYKTRQWHEKCFCCVVCKNPIGTKSFIPREQEIYCAACYE DKFATRCVKCNKIITSGGVTYKNEPWHRDCFTCSNCNNSLAGQRFTSRDDKPYCADCFGE LFAKRCTACSKPITGIGGTRFISFEDRHWHNDCFICAGCKTSLVGRGFITDGEDIICPDC AKMKLM |
|
| |