![]() |
||||||
| Home | List proteins by tissue | Protein search | Downloads | Links | ||
| Protein: 326439173 NP_001191991.1 cytochrome P450 6AQ1 |
Distribution (mouse over here![]() Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() ![]() |
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 42.5 | 13.3* | 44.2 | 0.96153843 | 0.300905 |
| Scape | 45.9 | 2.7 | 51.5 | 0.8912621 | 0.052427184 |
| Brain | |||||
| Crop | |||||
| Eye | |||||
| Intestine | 25.4 | 74.6 | 0.34048256 | ||
| Leg, front | 23.9* | 1.8* | 74.3 | 0.32166892 | 0.02422611 |
| Leg, middle | 20.6* | 0.8* | 78.6 | 0.2620865 | 0.010178117 |
| Leg, rear | 9.5* | 2.7* | 87.8 | 0.10820045 | 0.030751709 |
| Mandibular gland | |||||
| Rectum | 82.9 | 17.1 | 4.8479533 | ||
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | |||||
| Ventriculus | |||||
| Thoracic muscle | |||||
| Fat body | |||||
| Malpighian tubules | 45.3 | 4.7* | 50 | 0.906 | 0.094 |
| Nerve chord | |||||
| Poison sac | |||||
| Sting | |||||
| Heart | 16 | 84 | 0.1904762 | ||
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 29.1 | 16.8 | 62.5 | 0.4656 | 0.2688 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MNLLTPYWSLDILIVSSSLMIAVYLYASWKLKYWSRRGIMQITPSPLFGNFKKCILFQKS VSEIIRELYGQNEGLPFMGFYIFYKPFFLVRDIELVKHILVKDFNTFANKHTSADSKNDR IGYSNLFIIKNPAWKYLRGKLTSVFTSGKLKKMFDLMLIIGKNLEKHLELLNLDGNGKEV ELKDLCANFTTDLIGTTAFGVNLNSLKDPNSDFRENGRLVFDYNLKRAFEFFSIFFFPNL NKYFSVKFFGKATDYFRNSFWSVINQRIESNVKRNDLIDCLIELREKHKNDESFEGFRFD GDDLVSQAAIFFTGGFETSSTTISFTLYELALNKDIQKTVRTEIHEALAQTDGKITYDMI TNLPYLDMVVSETLRKYPPLGFLDRVALHDYKIPNSDVTIDKDTPVIIPMIAFHYDPKYF PNPEKYDPLRFSEEVKKTRPSYVYMPFGEGPHICIGMRLGLLQSKLGIIEILKDYEVSPC EKTKIPMVLDPKGLTTTALGGLYLNIRKITIAAG |
|
| |