| Protein: 328792073 XP_003251676.1 PREDICTED: v-type proton ATPase subunit H isoform 2 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | 30.1 | 30.1 | 39.8 | 0.75628144 | 0.75628144 |
| Scape | 34.5 | 22.7 | 42.8 | 0.80607474 | 0.5303738 |
| Brain | 59.4 | 40.6 | 1.4630542 | ||
| Crop | 54.8* | 27.7 | 17.5 | 3.1314285 | 1.5828571 |
| Eye | |||||
| Intestine | 30 | 25.7 | 44.3 | 0.6772009 | 0.58013546 |
| Leg, front | 48.4 | 25.1 | 26.4 | 1.8333334 | 0.95075756 |
| Leg, middle | 42.9 | 29.2 | 27.9 | 1.5376344 | 1.046595 |
| Leg, rear | 40.6 | 26.8 | 32.6 | 1.2453988 | 0.8220859 |
| Mandibular gland | |||||
| Rectum | 8.5 | 30.2 | 61.3 | 0.13866232 | 0.49265906 |
| Salivary gland, cerebral | 41.7 | 3.9 | 54.4 | 0.7665441 | 0.07169118 |
| Salivary gland, thoracic | 71 | 2* | 27 | 2.6296296 | 0.074074075 |
| Sternite | 24.1 | 75.9 | 0.31752306 | ||
| Tergite | |||||
| Ventriculus | 39.1 | 60.9 | 0.64203614 | ||
| Thoracic muscle | |||||
| Fat body | 50.5 | 31.9 | 17.5 | 2.8857143 | 1.8228571 |
| Malpighian tubules | 30.1 | 36.4 | 33.4 | 0.9011976 | 1.0898204 |
| Nerve chord | 16.4 | 48 | 35.5 | 0.46197182 | 1.3521127 |
| Poison sac | |||||
| Sting | 40.1 | 59.9 | 0.6694491 | ||
| Heart | 17.6 | 28.9 | 53.6 | 0.3283582 | 0.5391791 |
| Hypopharyngeal gland | 58 | 42 | 1.3809524 | ||
| Galea | 47 | 8.6* | 44.5 | 1.0561798 | 0.19325842 |
| Glossa | 46.9 | 53.1 | 0.88323915 | ||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 36.8 | 31 | 42.4 | 0.8679245 | 0.7311321 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MVDRVNIKEMIPALPDEKIDMLAATSILQQQAADIRNQQIKWQSYLQSHMISKEDHDFIV AFDTNDPNVRDAKLKENPHQAAKTFLNLLGHISKDQTIQYILTMIDDMLQEDRSRVEIFR EHSNRKRESVWGPFLNLLNRQDGFIMNMTSRIIAKLACWSHDLMEKTDLQFYLTWLKDQL KLSFEAPQDTNFHARVEQDNTMDKEANELHELQSPNNEYIQSVARCLQMMLRIDEYRFAF VSVDGISTLISVLSGRVNFQVQYQLIFCIWVLTFNPLLAEKMNKFSVIPILADILSDSVK EKVTRIILAVFRNLIEKVEDGQVAKEHCIAMVQCKVLKQLSILGQRKFDDEDITDDIEFL NDKLQASVQDLSSFDEYSTEVKSGRLEWSPVHKSGKFWRENANRLNEKNYELLRILVHLL ETSKDPLVLSVASFDVGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQK LMVHNWEYLGKQLEKEQTGTSNAPGTKPGAQVPAKA |
 Top
| |