| Protein: 48095159 XP_394370.1 PREDICTED: chymotrypsin-1 |
Distribution (mouse over here Sample of a protein distribution map. for a definition map of the organs displayed below): |
| Drone | Queen | Worker |
 |
|
|
The above diagram is generated from the following data: (Organs are coloured according to percent relative expression - 100% = black, 0% = white)
| Tissues | Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W |
| Flagellum | |||||
| Scape | |||||
| Brain | |||||
| Crop | 8.8* | 12.7 | 78.5 | 0.11210191 | 0.16178344 |
| Eye | |||||
| Intestine | 45.3 | 1.8* | 52.9 | 0.8563327 | 0.034026466 |
| Leg, front | |||||
| Leg, middle | |||||
| Leg, rear | |||||
| Mandibular gland | |||||
| Rectum | 0.5* | 0.8* | 98.7 | 0.005065856 | 0.00810537 |
| Salivary gland, cerebral | |||||
| Salivary gland, thoracic | |||||
| Sternite | |||||
| Tergite | 3 | 97 | 0.030927835 | ||
| Ventriculus | 67.3 | 14.1 | 18.6 | 3.6182795 | 0.7580645 |
| Thoracic muscle | |||||
| Fat body | 92.6 | 0.3* | 7.1 | 13.042253 | 0.04225352 |
| Malpighian tubules | 1.1* | 10.8* | 88.1 | 0.012485812 | 0.12258797 |
| Nerve chord | 6.7* | 6.7* | 86.6 | 0.07736721 | 0.07736721 |
| Poison sac | 8.5 | 91.5 | 0.09289618 | ||
| Sting | 1.4* | 98.6 | 0.014198783 | ||
| Heart | 13.2 | 7.6* | 79.2 | 0.16666667 | 0.0959596 |
| Hypopharyngeal gland | |||||
| Galea | |||||
| Glossa | |||||
| An asterisk (*) on D or Q values denote a significance difference from W (p<0.05). | |||||
| Drone(D)% | Queen(Q)% | Worker(W)% | D/W | Q/W | |
| Whole Body Average | 26.5 | 6.5 | 72.4 | 0.3660221 | 0.089779004 |
|
|||||
|
If there is a connecting line with an asterisk (*) between 2 castes, it indicates that their whole body averages are significantly different (p<0.05) from each other. |
|||||
| Sequence: |
MIALNVLSVLGFCLAVTAYGVPESKIVGGSDASSGQFPYQVSLRKNKSHFCGGSIIDSRT ILTAAHCVEGLSNLNGITVQAGTNQLNSGGVSYVPEKVVAHRSFNALSLVNDIALIRVNQ DISFTNLIQPIKLASGSKTYEGSDCILSGWGTTKLNGNVPNNLQWIKLKIETEQKCKQAH WRVQSSHICTFTKSGEGACHGDSGGPLVVGDLQVGIVSFGQPCAVGKPDVYTRVSSFTSW INEHKSFLMEERGEAPADGFYIS |
 Top
| |